KEGG   Comamonas testosteroni CNB-2: CtCNB1_1880Help
Entry
CtCNB1_1880       CDS       T01109                                 

Definition
ATPase associated with various cellular
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
ctt  Comamonas testosteroni CNB-2
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ctt00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CtCNB1_1880
Enzymes [BR:ctt01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     CtCNB1_1880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2122173..2123321)
Genome map
AA seq 382 aa AA seqDB search
MQALLLAAIEPQLGGVLIRGPRGTAKSTAARALADLLTPAPFVTLPLGASIEHVTGSLDL
SKALSGHEVGFAPGLIAKAHDGVLYVDEINLLPDAIVDVLLDVAASGINRIERDGISHSH
AARFVLIGTMNPEEGMLRPQLLDRLGLCVQLDNAQDPQLRSSIVKARLRFDQDPQGFARS
HATGQQEIRQRLTLARSRCRNASELTWSDAVHEAVALQCIAAQVDGLRADLVMLRAARAL
AAWQGSQSITPAHVSEVAPLVLQHRASQPDPGSSSQLRQPPAATPSAQPPATPATPSGAG
SAARTEPDTQAPASHSPATREPGATSSLPQEAGPSLEQPPAGWGQAQAVSSTAFDAQQAD
AMAQAALEALAAKKARASGPLR
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
gtgcaggccctgctgctcgccgcgatagagccgcagctgggcggcgtgctgattcgaggc
ccgcgcggcacggccaagtccacggcggcccgcgcgctggcggacctgctgacccctgcg
ccctttgtcaccctgccgctaggcgcttccatcgagcatgtgaccggcagtctggacctg
tccaaggcgctctcaggccacgaagtgggcttcgctccgggtctgattgccaaggcgcac
gacggcgtgctctatgtcgatgaaatcaatctgctgcccgatgccatcgtcgatgtgctg
cttgacgtggcggcctccggcatcaatcgcatagagcgcgacggcatctcgcacagccat
gccgcgcgctttgtgctgatcggcaccatgaaccccgaagaaggcatgctgcggccacag
ctgctggaccgactgggcctttgtgtgcaattggacaatgctcaggacccgcagctgcgc
agcagcatcgtcaaggcaaggctgcgctttgatcaggatccccagggcttcgcccgatct
catgcaaccgggcagcaggagattcgccaaaggctgacgctggcccgcagccgttgccgc
aatgcctcggagctgacatggagcgatgccgtccacgaggccgtggccctgcagtgcatt
gccgcccaggtggacggactgcgtgccgacctggtcatgctgcgtgctgcacgcgctctg
gcggcctggcaaggcagtcagagcatcacgcccgcacatgtgtccgaagtcgcgccactg
gtgctgcagcatcgcgccagccagccagatccgggcagctccagccagctgcggcagccc
cccgcagccacgccttccgcccagccgccggcaacgcccgccacaccgtcaggcgcgggc
agcgcagcccgcacagagcctgatacccaggcaccagcatctcattcaccggctacccgc
gagcccggcgccaccagctccttgcctcaagaggcaggcccgagcctcgaacagccgcct
gccggctggggacaggctcaagccgtgagcagcaccgccttcgatgcacaacaggccgat
gccatggcacaggcagccctggaggccctggccgcaaaaaaagcccgagcctccggtccg
ctgcgctga

DBGET integrated database retrieval system