KEGG   Comamonas testosteroni: CtCNB1_1926Help
Entry
CtCNB1_1926       CDS       T01109                                 

Definition
shikimate 5-dehydrogenase
Orthology
K00014  
shikimate dehydrogenase [EC:1.1.1.25]
Organism
ctt  Comamonas testosteroni
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:ctt01230]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:ctt00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2182890..2183702
Genome map
AA seq 270 aa AA seqDB search
MREITGNTQIFGILADPIHHVKTPQRINHLFAERQIDGVMVPLHVKPEGLAQAVQGLRMQ
QNLGGFIVTVPHKTAIVALCDELTPEARLIGAANVVHRKADGRLVGGMLDGEGFVNGLRS
QGLDPAKRSAYLVGAGGAASAIAFALASAGVSRLTVANRTADKAQQLIDRIAVIHPFLNL
VVGSENPAGHDLVVNATSLGLHPGDALPLDVERLEPGQIVAEIIMQPAQTPLLVAAEKKG
CRIHFGAPMLACQIELMAEFMGGLAPALSN
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgcgagaaatcaccggaaatacacaaatcttcggcattttggccgatcccattcaccat
gtgaaaacgccgcaacgcatcaatcatttgtttgccgagcgtcagattgacggggttatg
gtgcctttgcatgtgaagcccgagggtttggcgcaagcggtgcaaggcctgcgaatgcag
caaaacctgggtggctttattgtcaccgtgcctcacaaaactgccatcgtcgctctgtgt
gacgagttgacacccgaggcccgtctcatcggtgctgcgaacgttgtgcaccgcaaggcc
gatggtcgcctggtcggcgggatgctggacggcgagggtttcgtgaatggactacgcagc
cagggactggatccggccaagcgcagcgcctatcttgtcggtgccggtggtgcagcatcg
gccatcgcgtttgcgcttgccagcgccggtgtcagccgcctgaccgttgccaatcgcacg
gccgacaaagcacagcaattgattgatcgcattgccgtgatccatcctttcctgaatctg
gtcgtaggtagcgagaatccggccggccatgatctggtcgtcaatgcaacttctcttggg
cttcaccctggcgatgcgctgccgctggacgtggagcgactggagccaggccagatcgtc
gcggaaatcatcatgcaaccggcgcagacgccgttattggtggctgccgagaagaaaggc
tgccgtattcactttggtgcacccatgctggcttgccagattgagctgatggctgaattc
atgggcggtcttgcaccagcactaagcaactga

DBGET integrated database retrieval system