KEGG   Comamonas testosteroni: CtCNB1_1926Help
Entry
CtCNB1_1926       CDS       T01109                                 

Definition
shikimate 5-dehydrogenase
Orthology
K00014  
shikimate dehydrogenase [EC:1.1.1.25]
Organism
ctt  Comamonas testosteroni CNB-2
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:ctt00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CtCNB1_1926
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CtCNB1_1926
Enzymes [BR:ctt01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.25  shikimate dehydrogenase
     CtCNB1_1926
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2182890..2183702
Genome map
AA seq 270 aa AA seqDB search
MREITGNTQIFGILADPIHHVKTPQRINHLFAERQIDGVMVPLHVKPEGLAQAVQGLRMQ
QNLGGFIVTVPHKTAIVALCDELTPEARLIGAANVVHRKADGRLVGGMLDGEGFVNGLRS
QGLDPAKRSAYLVGAGGAASAIAFALASAGVSRLTVANRTADKAQQLIDRIAVIHPFLNL
VVGSENPAGHDLVVNATSLGLHPGDALPLDVERLEPGQIVAEIIMQPAQTPLLVAAEKKG
CRIHFGAPMLACQIELMAEFMGGLAPALSN
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgcgagaaatcaccggaaatacacaaatcttcggcattttggccgatcccattcaccat
gtgaaaacgccgcaacgcatcaatcatttgtttgccgagcgtcagattgacggggttatg
gtgcctttgcatgtgaagcccgagggtttggcgcaagcggtgcaaggcctgcgaatgcag
caaaacctgggtggctttattgtcaccgtgcctcacaaaactgccatcgtcgctctgtgt
gacgagttgacacccgaggcccgtctcatcggtgctgcgaacgttgtgcaccgcaaggcc
gatggtcgcctggtcggcgggatgctggacggcgagggtttcgtgaatggactacgcagc
cagggactggatccggccaagcgcagcgcctatcttgtcggtgccggtggtgcagcatcg
gccatcgcgtttgcgcttgccagcgccggtgtcagccgcctgaccgttgccaatcgcacg
gccgacaaagcacagcaattgattgatcgcattgccgtgatccatcctttcctgaatctg
gtcgtaggtagcgagaatccggccggccatgatctggtcgtcaatgcaacttctcttggg
cttcaccctggcgatgcgctgccgctggacgtggagcgactggagccaggccagatcgtc
gcggaaatcatcatgcaaccggcgcagacgccgttattggtggctgccgagaagaaaggc
tgccgtattcactttggtgcacccatgctggcttgccagattgagctgatggctgaattc
atgggcggtcttgcaccagcactaagcaactga

DBGET integrated database retrieval system