KEGG   Comamonas testosteroni CNB-2: CtCNB1_1975Help
Entry
CtCNB1_1975       CDS       T01109                                 

Definition
3-hydroxybutyrate dehydrogenase
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
ctt  Comamonas testosteroni CNB-2
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ctt00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    CtCNB1_1975
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    CtCNB1_1975
Enzymes [BR:ctt01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     CtCNB1_1975
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2237854..2238642)
Genome map
AA seq 262 aa AA seqDB search
MSMLKGKTALVTGSTSGIGLGIAIALARQGANIVLNGFGDVEAPRAQVLDAGKAAGIEVG
YHGADMSKAADIEAMMKYAAAEFGRVDILVNNAGIQHVAKVQDFPVEKWDAILAINLSSA
FHTTRLALPAMQQANWGRIINVASVHGLVGSAEKSAYVAAKHGIVGLTKVTALENATTGV
TCNAICPGWVLTPLVQKQVDAKAAAQGISNEDATRQLLGEKEPSMQFTTPEELGELAVFF
CSAAANNVRGVAWNMDGGWAAQ
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgtccatgttgaaaggcaaaaccgctctcgtgacgggatcgaccagcggaatcggccta
ggtatcgcaatcgctctggcgcgccagggtgccaatatcgtgctcaacggctttggcgat
gtcgaagcaccacgcgcccaggtgcttgatgccggcaaagcagccggtatcgaagtcggc
taccacggagcggacatgagcaaggccgccgacattgaagccatgatgaaatacgccgcc
gccgaattcggccgcgtcgacatcctggtcaacaacgccggcattcagcatgtggccaag
gtgcaggacttccccgtggagaagtgggatgccatcctcgccatcaacctgagcagcgcc
ttccacaccacgcgcctggccctgcccgccatgcagcaggccaactggggccgcatcatc
aatgtggcctcggtacacggcctggtcggctcggccgaaaaatcggcttatgtcgccgcc
aagcacggcatcgtcggcctgaccaaggtgacggcgctggaaaacgccaccaccggcgtg
acctgcaacgccatctgccccggctgggtgctgacgccgctggtacaaaagcaggtggat
gccaaggctgccgcccaaggcatcagcaatgaagacgccaccaggcagctgctgggagaa
aaagagccttcgatgcagttcaccacgcccgaagagctaggcgagctggccgtcttcttc
tgctcggccgcggccaacaatgtgcgcggcgtggcatggaatatggacggcggctgggcc
gcacaataa

  All links  
No link information was found.   
DBGET integrated database retrieval system