KEGG   Comamonas testosteroni CNB-2: CtCNB1_2030Help
Entry
CtCNB1_2030       CDS       T01109                                 

Definition
inositol monophosphatase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
ctt  Comamonas testosteroni CNB-2
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ctt00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    CtCNB1_2030
Enzymes [BR:ctt01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     CtCNB1_2030
Transfer RNA biogenesis [BR:ctt03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    CtCNB1_2030
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2302365..2303102
Genome map
AA seq 245 aa AA seqDB search
MAITREAGALIMKIYRYDFEVRGKQDASPVTEADEKAERLILERLGALQSQFPVVSEEAA
AAGYVPEMGQCFWLVDPLDGTKEFINRNGEFTVNIALIENGTPVLGVVFAPALDRMYSGA
IGLGAWLEMQGKRQAIECRSIPEDGLDVVASRSHGDADALDQFLNGRLVRSLKSAGSSLK
ICLIAEGEADLYPRLGRTMEWDIAAGHAVLAAAGGQIHALNGDVLSYGKRDLSNPHFYAC
SADYR
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atggccatcacccgtgaagcgggtgctttaatcatgaagatctaccgctacgactttgag
gtacgcggcaagcaggatgcatcgcccgtgactgaagccgacgaaaaggccgagcgcctg
attcttgagcgtctgggcgccttgcagtcgcagtttcccgtcgtctccgaggaggcggct
gcagcgggatatgtgcctgagatggggcaatgcttctggctggttgatcctcttgatggc
accaaggaattcatcaaccgcaatggcgagttcacagtcaatatcgcgctgatcgaaaat
ggaacccctgtgctgggtgtcgttttcgctccggcgctggatcgcatgtactctggagcc
ataggacttggcgcatggctggagatgcagggaaagcgccaagccatcgaatgcagaagc
attccggaggatggccttgatgtggtggccagtcgttcgcacggcgatgccgatgcgctt
gatcagtttctcaatgggcgcttggtgcggtcactcaaaagtgcgggctcatcgctcaag
atttgtctgatcgcagagggagaggctgacctctatccacgcttggggcgcaccatggag
tgggatatcgctgcgggtcatgcggtgctggccgcggcaggcggccagattcatgcgctc
aatggagatgttctgagctacggcaagcgagatttgagtaaccctcatttctatgcctgc
tcggcagattaccgctga

DBGET integrated database retrieval system