KEGG   Comamonas testosteroni CNB-2: CtCNB1_2133Help
Entry
CtCNB1_2133       CDS       T01109                                 

Definition
(RefSeq) 2-oxoglutarate dehydrogenase, E2 subunit
  KO
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
ctt  Comamonas testosteroni CNB-2
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ctt00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CtCNB1_2133
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CtCNB1_2133
  Amino acid metabolism
   00310 Lysine degradation
    CtCNB1_2133
Enzymes [BR:ctt01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     CtCNB1_2133
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2429887..2431143
Genome map
AA seq 418 aa AA seqDB search
MAIVEVKVPQLSESITEATMLTWKKKVGEAVAVDEILIEIETDKVVLEVPAPSAGVITEI
LQGDGATVAAEQVIAKIDSEAVAGAAAPAAAPAAAATPAAATPAAAPVAAAPAGADKSGV
AMPAAAKILADNNLSAANVAGTGKDGRVTKGDALGAIKAGAAIPTGAPKAALPQVAAPVT
KENLGDRPEQRVPMTRLRARIAERLLQSQATNAILTTFNEVNMAPVMELRKKFQDQFTKE
HGVKLGFMSFFVKAAVHALKKFPAVNASIDGNDIVYHGYFDIGIAVSSPRGLVVPILRNA
DQMSFADIEKKIVEFGQKAKEGKLGIEEMTGGTFSISNGGTFGSMMSTPIINPPQSAILG
VHATKDRAVVENGQIVIRPMNYLAMSYDHRIIDGREAVLSLVAMKDALEDPSRLLFDL
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atggcaatcgttgaagttaaagtcccccagctgtccgaatccatcactgaagccaccatg
ctgacctggaagaaaaaggtcggcgaggccgtggccgtcgatgaaatcctcatcgaaatc
gaaaccgataaggttgtgctggaagtgcccgctccttcggctggcgtgatcaccgaaatc
ctgcaaggcgacggcgcaaccgtggctgccgagcaagtgatcgccaagatcgactccgaa
gccgtcgcaggcgccgctgctcctgctgccgcccccgctgctgctgcgactcctgctgct
gcgactcctgctgctgcccccgtggccgccgctcctgccggcgccgacaagagcggcgtg
gccatgcctgctgctgccaagatcctggccgacaacaacctgtccgctgccaacgtggcc
ggcacaggcaaggacggccgcgtgaccaagggtgacgctctgggtgccatcaaggctggc
gcagccatccccaccggcgctcccaaggcggctctgcctcaggtggcagctcccgtgacc
aaggaaaacctgggcgaccgtcccgagcagcgcgtgcccatgacacgtctgcgtgcccgt
attgccgagcgtctgctgcaatcccaggctaccaacgccatcttgaccacgttcaacgaa
gtgaacatggctcccgtgatggagctgcgcaagaagttccaggaccagttcaccaaggaa
catggcgtgaagctgggcttcatgtccttcttcgtcaaggctgcagtgcatgccctgaag
aagttccccgcagtcaatgcctccatcgatggcaacgacatcgtctaccacggctacttc
gacatcggtatcgctgtgagctcgcctcgcggcctggtggtgcccatcctgcgcaatgcc
gaccagatgagctttgccgacatcgaaaagaagattgtcgaattcggtcagaaggccaag
gaaggcaagctgggcattgaagaaatgaccggcggcaccttctccatctccaatggcggc
accttcggctcgatgatgtccacccccatcatcaacccccctcagtccgccattctgggc
gtgcacgccaccaaggatcgcgccgtggtcgagaacggtcagatcgtgatccgtcccatg
aactacctggccatgtcctatgaccaccgcatcatcgacggccgcgaagccgtgctgagc
ctggtggccatgaaggacgcgctggaagatccttctcgcctcctgtttgatctgtaa

DBGET integrated database retrieval system