KEGG   Comamonas testosteroni CNB-2: CtCNB1_2248Help
Entry
CtCNB1_2248       CDS       T01109                                 

Definition
pyruvate dehydrogenase complex dihydrolipoamide
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
ctt  Comamonas testosteroni CNB-2
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ctt00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CtCNB1_2248
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CtCNB1_2248
   00020 Citrate cycle (TCA cycle)
    CtCNB1_2248
   00620 Pyruvate metabolism
    CtCNB1_2248
Enzymes [BR:ctt01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     CtCNB1_2248
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2568005..2569696
Genome map
AA seq 563 aa AA seqDB search
MALTEIKVPDIGDFSEVGVIEVLVKVGDTIKVEQSLITVESDKASMEIPSSQAGVVKEIK
VALGDKVKEGSVVVMLETADAAPAPAAAAPVPVAAPVAAAPAPVAAAPVAAAPAASSTVD
LKIPDIGDFKDVAVIEMLVKVGDTVTAEQSLFTVESDKASMEIPSPSAGTITALTIKLGD
TVNVGDVVGQMTVQGAAAAPVQAAAPVAAPVAAPVAAAPAPVVAAPVAATPAAAPVAAPA
AHNPTVAPSGQLPHASPSVRKFARELGVPLAEVKGSGNKGRITAKDIQSFTKSVMAGAVQ
TLAQQAVAPKSSGGNVGGLEVLAWPKVDFAKFGSVERKELSRIKKISGANLHRNWVVIPH
VTNNDEADITELEAFRVQTNAESAKAKSDVKVTMLAFVIKAVVAALKKFPEFNASLDGDT
LVYKQYFNIGFAADTPNGLVVPVLKDADKKGILQISQEMGELAKKARDGKLGAADMQGGC
FSISSLGGIGGTNFTPIINAPEVAILGLSKGAMKPVWDGKQFVPRLMLPLSLSYDHRVID
GAAAARFNAYLGAVLADYRRILL
NT seq 1692 nt NT seq  +upstreamnt  +downstreamnt
atggcattgacagaaatcaaggtccccgatattggcgacttctccgaagtcggcgtgatc
gaagtgctggtcaaggtgggtgacaccatcaaggtcgagcaatccctgattaccgtggag
tccgacaaggcttccatggaaatcccctccagccaggctggcgtggtcaaggaaatcaag
gttgccctgggcgacaaggtcaaggaaggctccgtggtcgtgatgctggagactgccgat
gcagctcccgcacctgccgccgcagcgcctgttcctgttgcagcacccgtggccgcagct
cctgcccccgtggctgcagcccctgtggccgccgctcctgcagcatcctccaccgtggac
ctgaagatccccgatatcggcgacttcaaggacgtggccgtgatcgagatgctggtcaag
gtgggtgacaccgtgaccgccgagcaatcgctgtttaccgtggagtccgacaaggcctcg
atggaaatcccttcgccctcggccggcaccatcacggcgctgaccatcaagctgggtgac
accgtcaacgtgggcgacgtcgtcggccagatgacagtgcagggcgcagctgctgccccc
gtgcaggccgccgctcccgtggcggcaccggttgccgctcctgtggctgcagcacctgca
cccgtggttgcagcccctgtggccgccactcctgctgccgcacctgtggcagcgcctgca
gcccacaaccccaccgtggcgccttcgggtcaactgccccatgcctcgccttcggtgcgc
aagttcgctcgcgaactgggcgtgcctctggcagaagtcaagggctcgggcaacaagggc
cgcatcacggcgaaagacatccagtccttcaccaagtcggtgatggccggcgccgtgcag
accctggctcagcaggccgtggctcccaagtcttccggcggcaacgtcggcggtctggaa
gtgctggcctggcccaaggtcgacttcgccaagttcggctctgtcgagcgcaaggaactg
tcgcgcatcaagaagatctcgggcgccaacctgcatcgcaactgggtggtcatcccccac
gtcaccaacaatgacgaggccgacatcaccgagctggaagccttccgtgtgcagaccaat
gccgaaagcgccaaggccaagagcgacgtcaaggtgacgatgctggctttcgtgatcaag
gccgtggtggctgcgctcaagaagttccccgagttcaacgcctctctggatggcgacact
ctggtctacaagcagtacttcaacatcggctttgccgctgacacaccgaacggcctggtc
gttcccgtgctcaaggacgccgacaagaagggcatcctgcagatcagccaggaaatgggc
gagctggccaagaaggcccgcgacggcaagctgggcgctgcggacatgcaaggcggctgc
ttctcgatctcgtctctgggcggcatcggcggcaccaacttcacgcccatcatcaatgcg
cctgaagtcgccatcctgggtctgtccaagggcgccatgaagcccgtgtgggacggcaag
cagttcgtgcctcgtctgatgctgcctctgtcgctgtcgtacgaccaccgcgtcatcgac
ggtgcagccgctgcacgcttcaacgcctacctgggcgctgtgctggccgactaccgccgc
atcctgctctaa

DBGET integrated database retrieval system