KEGG   Comamonas testosteroni: CtCNB1_2346Help
Entry
CtCNB1_2346       CDS       T01109                                 

Definition
succinyl-diaminopimelate desuccinylase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
ctt  Comamonas testosteroni
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:ctt01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:ctt00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2679833..2681014
Genome map
AA seq 393 aa AA seqDB search
MTEQLISLPSVTPEDAGCLELLADALTPMGFTCERLDSGPADFRVQNLWAKRAPAIAQST
QGAINSDRPVLVFAGHTDVVPPGPLKEWTSPPFVPMHRDGKLYGRGASDMKTSIAAFVVA
LEEFLQTMPEPAFDIALLLTSDEEGPSVDGTKVVVEELRQRGERLDWCIVGEPTSVKQTG
DMIKNGRRGTMSGKLTVNGVQGHIAYPQLARNPIHEALPALAELAATVWDRGNAFFPPTS
WQISNIHGGTGASNVIPGHVVIDFNFRFCTESSSDSLQKRVHEILDRHGVEYSLVWTVGG
QPFLTTPGTLVQAVQAAIKDETGLDTELSTTGGTSDGRFIAQICPQVIEMGPPNASIHKI
DEHIAVADIEPLKNIYRKTLEQLQRQQTAPQTA
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
ttgaccgagcagctcatcagcctgccctccgtcacccccgaagatgctggctgccttgag
ctgctcgccgatgccctgacacccatgggttttacctgcgaacgcctggatagcggcccc
gcagactttcgcgtacaaaacctgtgggcaaagcgcgctcctgcgattgctcagtctacg
caaggcgctatcaattcagataggcctgtgctggtctttgccggccataccgatgtggtg
ccaccgggcccgctcaaggaatggaccagcccgcctttcgtccccatgcaccgcgacggc
aagctctacggccgtggtgccagcgatatgaagacctccatcgccgcctttgtcgtggcg
ctggaggagtttctgcagaccatgcccgagcccgccttcgacatcgccctgctgctgacc
agcgacgaggaaggcccctcggtcgacggcaccaaggtcgtggttgaagagctgcgccag
cgcggcgagcgcctggactggtgcatcgtgggcgagcccacctcggtcaagcagaccggc
gacatgatcaagaacggccgccgcggcaccatgagcggcaagctcaccgtcaacggtgtg
caaggccatatcgcctacccgcaactggcacgcaaccccattcacgaggccttgcccgca
ctcgcagaactcgcggccacggtctgggaccgcggcaatgcattcttcccgcccacaagc
tggcagatcagcaatattcatggcggtacgggcgccagcaacgtcattcccggccatgtg
gtgatcgacttcaatttccgcttctgtaccgagtccagttccgactccctgcaaaagcgc
gtgcatgaaatcctggaccgccatggcgtcgaatactcgctggtctggaccgtgggcggc
cagccctttctgaccacgccgggcaccctggtacaggccgtgcaggccgccatcaaggat
gaaaccggactcgataccgagctgtccaccacaggcggcaccagcgatggccgcttcatc
gcccagatatgccctcaggtcatagagatgggcccgcccaatgccagcatccacaagatc
gacgaacacatcgccgtggccgatatcgagccactgaaaaacatctaccgcaagactctg
gaacaactccagcgccagcagaccgcaccccagaccgcatga

DBGET integrated database retrieval system