KEGG   Comamonas testosteroni: CtCNB1_2946Help
Entry
CtCNB1_2946       CDS       T01109                                 

Definition
lipolytic enzyme, G-D-S-L
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
ctt  Comamonas testosteroni
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:ctt00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    CtCNB1_2946
Enzymes [BR:ctt01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     CtCNB1_2946
   3.1.2  Thioester hydrolases
    3.1.2.-  
     CtCNB1_2946
Lipid biosynthesis proteins [BR:ctt01004]
 Fatty acid synthase
  Component type
   CtCNB1_2946
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3347852..3348589
Genome map
AA seq 245 aa AA seqDB search
MDMNQLDSKNVKSRNQHFALQRRHCIAVALSLAISGACGAAVASSPARNKEPAKAAPGAK
PGPVLVLGDSLSAEYGLTRGKGWVQLLQQRMNDEKNPRKVVNASISGETTAGGRARLASL
LRQHEPGILILELGGNDALRGLALQSTQQNLEVMIKAAREAGAQVLLVGMQVPPNYGATY
TEQFAEMFRSIADAQKLPLVPFLLSGIGDAANAEQWFQSDRIHPNAQAQPQMLANVWPKL
RPLLK
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
gtggacatgaatcaattggatagcaaaaacgtcaagagtcgcaaccagcactttgcactg
cagcgccgtcactgtatcgctgttgctctgtcgctcgccatttcaggggcttgcggtgcg
gcagtggcctcatcgcccgccaggaacaaggagccggccaaggccgctcccggcgcgaaa
cccggcccggtgctggtgcttggcgattctctgagcgccgaatacggcctgacgcgcggc
aagggctgggtgcagttgctgcagcagcgcatgaatgacgaaaagaatccgcgcaaggtg
gtcaatgccagcatcagcggcgagaccacggccggcggcagagcgcgcctggcgtcgctg
ctcaggcagcatgagccgggcatcctgattctggagctgggcggcaacgacgcattgcgc
ggcctggcgctgcagagcactcagcagaatctggaagtcatgatcaaggccgccagggag
gccggggcccaggtgctgctggtgggcatgcaggtaccgccaaactatggagcgacatat
accgagcaatttgccgagatgttcaggagcattgccgacgcgcaaaaactgccgctggtg
ccgtttctgctgtcgggcatcggcgatgcggcgaacgccgagcagtggtttcagagcgac
cgcattcaccccaatgcccaggcccagccccagatgctggccaatgtctggcccaagctc
aggccattgctgaaataa

DBGET integrated database retrieval system