KEGG   Comamonas testosteroni CNB-2: CtCNB1_3032Help
Entry
CtCNB1_3032       CDS       T01109                                 

Definition
(GenBank) isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
ctt  Comamonas testosteroni CNB-2
Pathway
ctt00630  Glyoxylate and dicarboxylate metabolism
ctt01100  Metabolic pathways
ctt01110  Biosynthesis of secondary metabolites
ctt01120  Microbial metabolism in diverse environments
ctt01200  Carbon metabolism
Module
ctt_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:ctt00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    CtCNB1_3032
Enzymes [BR:ctt01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     CtCNB1_3032
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase
Motif
Other DBs
NCBI-ProteinID: ACY33778
UniProt: D0J189
Position
complement(3446976..3448307)
Genome map
AA seq 443 aa AA seqDB search
MPQSLTQQLSREQQIAALEKDWAQNPRWKSVKRGYSAADVVRLRGSLQPEYTLAQRGAEV
LWDKINGSSKKGYVNAFGAISAGQAMQQAKAGLEAVYLSGWQVAADGNTSETMYPDQSLY
AYDSVPTMVRRINNTFKRADEIQWGKGINPGDKEFIDYFLPIVADAEAGFGGVLNAFELM
KNMIQAGAAGVHFEDQLAAVKKCGHMGGKVLVPTREAVEKLIAARFAADVMGVPTIVLAR
TDAEAANLITSNHDENDIPFLTGERTQEGFYRVKNGLEQSISRGVAYAPYADLVWCETGV
PDIGFAREFAQAVHAACPGKLLSYNCSPSFNWKKNLNDSQIASFQEDLSALGYKFQFITL
AGIHSNWYNTFKFAHEYARGEGMKHYVEMIQEPEFAARDKGYTFVSHQQEVGAGYFDDVT
TVIQGGSSSVKALTGSTEEEQFH
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atgccccaatccctgactcagcaactgagccgtgaacagcaaatcgcagccctcgaaaaa
gactgggcacagaacccacgctggaagagcgtcaagcgcggctacagcgctgccgatgtg
gtgcgtctgcgtggcagcctgcagccagagtacaccctggcccagcgcggtgctgaagtg
ctgtgggacaagatcaacggcagctcgaagaagggctatgtgaacgccttcggtgccatc
tctgcaggccaggccatgcagcaggccaaggccggtctggaagccgtgtacctgtcgggc
tggcaagtagctgccgacggcaacacctccgagaccatgtaccccgaccagtcgctgtac
gcctatgactccgtgcccaccatggtgcgccgcatcaacaacaccttcaagcgcgccgat
gaaatccaatggggcaagggcatcaaccccggcgacaaggagttcatcgactacttcctg
cccatcgtggctgatgcggaagccggctttggcggcgtgctcaacgcgttcgagttgatg
aagaacatgattcaggcaggtgctgccggagtgcacttcgaagaccagctggctgcggtc
aagaagtgcggccacatgggcggcaaggtgctggtgcccacccgcgaagcggtcgaaaag
ctgattgccgcccgttttgcagccgacgtgatgggcgtgcccaccattgtgctggcccgt
accgatgccgaggcggccaacctgatcaccagcaaccatgacgagaacgacatcccgttc
ctgactggcgagcgtactcaggaaggcttctaccgtgtcaagaacggtctggagcaatcc
atcagccgcggcgtggcctacgctccctatgcggatctggtgtggtgcgaaaccggcgtg
cccgatatcggctttgcccgcgaattcgctcaggccgtgcatgccgcctgcccaggcaag
ctgctgagctacaactgctcgccttcattcaactggaagaagaacctcaacgacagccag
atcgcctccttccaggaagatctgtccgcactgggctacaagttccagttcatcacgctg
gccggcattcacagcaactggtacaacaccttcaagtttgcccacgagtacgctcgcggc
gagggcatgaagcactacgtggaaatgatccaggagcccgaattcgcggcacgtgacaag
ggctacacctttgtctcgcaccagcaggaagtgggcgcaggttacttcgacgatgtgacc
accgtgatccagggcggctcttccagcgtcaaggcgctgaccggttccaccgaggaagag
cagttccattga

DBGET integrated database retrieval system