KEGG   Comamonas testosteroni: CtCNB1_3032Help
Entry
CtCNB1_3032       CDS       T01109                                 

Definition
isocitrate lyase
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
ctt  Comamonas testosteroni
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:ctt01200]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:ctt00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3446976..3448307)
Genome map
AA seq 443 aa AA seqDB search
MPQSLTQQLSREQQIAALEKDWAQNPRWKSVKRGYSAADVVRLRGSLQPEYTLAQRGAEV
LWDKINGSSKKGYVNAFGAISAGQAMQQAKAGLEAVYLSGWQVAADGNTSETMYPDQSLY
AYDSVPTMVRRINNTFKRADEIQWGKGINPGDKEFIDYFLPIVADAEAGFGGVLNAFELM
KNMIQAGAAGVHFEDQLAAVKKCGHMGGKVLVPTREAVEKLIAARFAADVMGVPTIVLAR
TDAEAANLITSNHDENDIPFLTGERTQEGFYRVKNGLEQSISRGVAYAPYADLVWCETGV
PDIGFAREFAQAVHAACPGKLLSYNCSPSFNWKKNLNDSQIASFQEDLSALGYKFQFITL
AGIHSNWYNTFKFAHEYARGEGMKHYVEMIQEPEFAARDKGYTFVSHQQEVGAGYFDDVT
TVIQGGSSSVKALTGSTEEEQFH
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atgccccaatccctgactcagcaactgagccgtgaacagcaaatcgcagccctcgaaaaa
gactgggcacagaacccacgctggaagagcgtcaagcgcggctacagcgctgccgatgtg
gtgcgtctgcgtggcagcctgcagccagagtacaccctggcccagcgcggtgctgaagtg
ctgtgggacaagatcaacggcagctcgaagaagggctatgtgaacgccttcggtgccatc
tctgcaggccaggccatgcagcaggccaaggccggtctggaagccgtgtacctgtcgggc
tggcaagtagctgccgacggcaacacctccgagaccatgtaccccgaccagtcgctgtac
gcctatgactccgtgcccaccatggtgcgccgcatcaacaacaccttcaagcgcgccgat
gaaatccaatggggcaagggcatcaaccccggcgacaaggagttcatcgactacttcctg
cccatcgtggctgatgcggaagccggctttggcggcgtgctcaacgcgttcgagttgatg
aagaacatgattcaggcaggtgctgccggagtgcacttcgaagaccagctggctgcggtc
aagaagtgcggccacatgggcggcaaggtgctggtgcccacccgcgaagcggtcgaaaag
ctgattgccgcccgttttgcagccgacgtgatgggcgtgcccaccattgtgctggcccgt
accgatgccgaggcggccaacctgatcaccagcaaccatgacgagaacgacatcccgttc
ctgactggcgagcgtactcaggaaggcttctaccgtgtcaagaacggtctggagcaatcc
atcagccgcggcgtggcctacgctccctatgcggatctggtgtggtgcgaaaccggcgtg
cccgatatcggctttgcccgcgaattcgctcaggccgtgcatgccgcctgcccaggcaag
ctgctgagctacaactgctcgccttcattcaactggaagaagaacctcaacgacagccag
atcgcctccttccaggaagatctgtccgcactgggctacaagttccagttcatcacgctg
gccggcattcacagcaactggtacaacaccttcaagtttgcccacgagtacgctcgcggc
gagggcatgaagcactacgtggaaatgatccaggagcccgaattcgcggcacgtgacaag
ggctacacctttgtctcgcaccagcaggaagtgggcgcaggttacttcgacgatgtgacc
accgtgatccagggcggctcttccagcgtcaaggcgctgaccggttccaccgaggaagag
cagttccattga

DBGET integrated database retrieval system