KEGG   Comamonas testosteroni CNB-2: CtCNB1_3148Help
Entry
CtCNB1_3148       CDS       T01109                                 

Definition
Semialdehyde dehydrogenase, NAD - binding protein
Orthology
K18366  
acetaldehyde/propanal dehydrogenase [EC:1.2.1.10 1.2.1.87]
Organism
ctt  Comamonas testosteroni CNB-2
Pathway
Benzoate degradation
Pyruvate metabolism
Dioxin degradation
Xylene degradation
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Module
Catechol meta-cleavage, catechol => acetyl-CoA / 4-methylcatechol => propanoyl-CoA
Brite
KEGG Orthology (KO) [BR:ctt00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    CtCNB1_3148
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    CtCNB1_3148
   00650 Butanoate metabolism
    CtCNB1_3148
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CtCNB1_3148
   00622 Xylene degradation
    CtCNB1_3148
   00621 Dioxin degradation
    CtCNB1_3148
Enzymes [BR:ctt01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     CtCNB1_3148
    1.2.1.87  propanal dehydrogenase (CoA-propanoylating)
     CtCNB1_3148
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3565424..3566344)
Genome map
AA seq 306 aa AA seqDB search
MKKIKCALIGPGNIGTDLLAKLQRSPVLEPVWMVGIDPDSDGLKRAREMGIKTTAEGVDG
LLPHMQADGVQIVFDATSAYVHAENSRKVNEQGALMIDLTPAAIGPFCVPPVNLMQHLGS
GAMNVNMVTCGGQATIPMVAAVSRVQAVAYGEIVATVSSKSVGPGTRKNIDEFTRTTAGA
VEKVGGAKKGKAIIVINPAEPPLMMRDTVHCLTEDEPDQATITASIHQMLAEVQKYVPGY
RLVNGPVFDGKRVSVFLEVEGLGDYLPKYAGNLDIMTAAAARTAEMFAEQMLAGKLTLAP
MAPVAA
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaatcaaatgtgcgctgatcgggccgggcaatatcggcaccgatctgttggcc
aagctgcagcgcagccccgtgctggagccggtttggatggtgggcatagaccccgattcg
gatggcttgaagcgggcgcgtgaaatgggcatcaagaccacggctgagggcgtggacggg
ctgctgccgcatatgcaggccgatggtgtgcaaatcgtgttcgacgccaccagtgcctat
gtccatgccgagaactcgcgcaaggtcaacgaacaaggtgcgctgatgattgacctcacg
ccggcggccataggccctttctgcgtgcccccggtcaatctgatgcagcacctgggcagc
ggcgccatgaatgtgaacatggtcacctgcggcggccaggccaccattcccatggtggcg
gcggtgagccgcgtgcaggccgtggcctatggtgagatcgtggccaccgtgtcctccaag
tccgtgggaccgggcacgcgcaagaacattgacgaattcacgcgcaccacagcaggtgcg
gtggagaaggtaggcggtgccaaaaaaggcaaggccatcatcgtcatcaacccggccgaa
ccccctttgatgatgcgcgacaccgtgcactgcctgaccgaggacgagcccgaccaggcc
accatcaccgcctccatccaccagatgctggccgaggtgcagaaatacgtgcccggttac
cgcctggtcaacggcccggtgtttgacggcaagcgcgtctccgtcttcctcgaggtcgaa
ggcctgggcgactacctgcccaagtacgcgggcaatctggacatcatgactgccgccgcc
gcgcgcacggccgagatgttcgccgaacaaatgctggccggcaagctcacgctcgcaccc
atggcccccgtagccgcctga

DBGET integrated database retrieval system