KEGG   Comamonas testosteroni CNB-2: CtCNB1_3148Help
Entry
CtCNB1_3148       CDS       T01109                                 

Definition
(GenBank) Semialdehyde dehydrogenase, NAD - binding protein
  KO
K18366  acetaldehyde/propanal dehydrogenase [EC:1.2.1.10 1.2.1.87]
Organism
ctt  Comamonas testosteroni CNB-2
Pathway
ctt00362  Benzoate degradation
ctt00620  Pyruvate metabolism
ctt00621  Dioxin degradation
ctt00622  Xylene degradation
ctt00650  Butanoate metabolism
ctt01100  Metabolic pathways
ctt01120  Microbial metabolism in diverse environments
ctt01220  Degradation of aromatic compounds
Module
ctt_M00569  Catechol meta-cleavage, catechol => acetyl-CoA / 4-methylcatechol => propanoyl-CoA
Brite
KEGG Orthology (KO) [BR:ctt00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    CtCNB1_3148
   00650 Butanoate metabolism
    CtCNB1_3148
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CtCNB1_3148
   00622 Xylene degradation
    CtCNB1_3148
   00621 Dioxin degradation
    CtCNB1_3148
Enzymes [BR:ctt01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     CtCNB1_3148
    1.2.1.87  propanal dehydrogenase (CoA-propanoylating)
     CtCNB1_3148
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetDehyd-dimer Semialdhyde_dh NAD_binding_3 Sacchrp_dh_NADP GFO_IDH_MocA
Motif
Other DBs
NCBI-ProteinID: ACY33894
UniProt: D0J1Z1
Position
complement(3565424..3566344)
Genome map
AA seq 306 aa AA seqDB search
MKKIKCALIGPGNIGTDLLAKLQRSPVLEPVWMVGIDPDSDGLKRAREMGIKTTAEGVDG
LLPHMQADGVQIVFDATSAYVHAENSRKVNEQGALMIDLTPAAIGPFCVPPVNLMQHLGS
GAMNVNMVTCGGQATIPMVAAVSRVQAVAYGEIVATVSSKSVGPGTRKNIDEFTRTTAGA
VEKVGGAKKGKAIIVINPAEPPLMMRDTVHCLTEDEPDQATITASIHQMLAEVQKYVPGY
RLVNGPVFDGKRVSVFLEVEGLGDYLPKYAGNLDIMTAAAARTAEMFAEQMLAGKLTLAP
MAPVAA
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaatcaaatgtgcgctgatcgggccgggcaatatcggcaccgatctgttggcc
aagctgcagcgcagccccgtgctggagccggtttggatggtgggcatagaccccgattcg
gatggcttgaagcgggcgcgtgaaatgggcatcaagaccacggctgagggcgtggacggg
ctgctgccgcatatgcaggccgatggtgtgcaaatcgtgttcgacgccaccagtgcctat
gtccatgccgagaactcgcgcaaggtcaacgaacaaggtgcgctgatgattgacctcacg
ccggcggccataggccctttctgcgtgcccccggtcaatctgatgcagcacctgggcagc
ggcgccatgaatgtgaacatggtcacctgcggcggccaggccaccattcccatggtggcg
gcggtgagccgcgtgcaggccgtggcctatggtgagatcgtggccaccgtgtcctccaag
tccgtgggaccgggcacgcgcaagaacattgacgaattcacgcgcaccacagcaggtgcg
gtggagaaggtaggcggtgccaaaaaaggcaaggccatcatcgtcatcaacccggccgaa
ccccctttgatgatgcgcgacaccgtgcactgcctgaccgaggacgagcccgaccaggcc
accatcaccgcctccatccaccagatgctggccgaggtgcagaaatacgtgcccggttac
cgcctggtcaacggcccggtgtttgacggcaagcgcgtctccgtcttcctcgaggtcgaa
ggcctgggcgactacctgcccaagtacgcgggcaatctggacatcatgactgccgccgcc
gcgcgcacggccgagatgttcgccgaacaaatgctggccggcaagctcacgctcgcaccc
atggcccccgtagccgcctga

DBGET integrated database retrieval system