KEGG   Comamonas testosteroni CNB-2: CtCNB1_3271Help
Entry
CtCNB1_3271       CDS       T01109                                 

Definition
(GenBank) glutamine synthetase, type I
  KO
K01915  glutamine synthetase [EC:6.3.1.2]
Organism
ctt  Comamonas testosteroni CNB-2
Pathway
ctt00220  Arginine biosynthesis
ctt00250  Alanine, aspartate and glutamate metabolism
ctt00630  Glyoxylate and dicarboxylate metabolism
ctt00910  Nitrogen metabolism
ctt01100  Metabolic pathways
ctt01120  Microbial metabolism in diverse environments
ctt01230  Biosynthesis of amino acids
ctt02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ctt00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    CtCNB1_3271
  Energy metabolism
   00910 Nitrogen metabolism
    CtCNB1_3271
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CtCNB1_3271
   00220 Arginine biosynthesis
    CtCNB1_3271
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    CtCNB1_3271
Enzymes [BR:ctt01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.1  Acid-D-ammonia (or amine) ligases (amide synthases)
    6.3.1.2  glutamine synthetase
     CtCNB1_3271
Exosome [BR:ctt04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CtCNB1_3271
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Gln-synt_C Gln-synt_N
Motif
Other DBs
NCBI-ProteinID: ACY34017
UniProt: D0J2P4
Position
complement(3708494..3709909)
Genome map
AA seq 471 aa AA seqDB search
MAKTVADVMQMVQDNEVKFVDLRFTDTRGKEQHVTVPVSHFDEDKFASGHAFDGSSVAGW
KGIEASDMQLVPDPNTANIDPFFEETTLILQCDVIEPGDGKAYDRDPRSIAKRAEAYLKA
SGLGDTAYFGPEPEFFIFDGVRWGTEPHNPFFEIEEYEAPWNTGTKFETGNRGHRPRVKG
GYFPVPPVDSTQDMRAEMSLLLEAVGIPVEVFHHEVAGAGQNEIGTRFSTLVERADWTQL
QKYIIWNVANTYGKTATFMPKPYAGDNGSGMHVHQSVWKDGKNLFAGDGYAGLSDFALYY
IGGIIKHARALNAITNPGTNSYKRLVPGFEAPVKLAYSAKNRSASIRIPYVSNPKARRVE
ARFPDPLMNPYLGFAALLMAGLDGVENKIHPGEAATKDLYHLPPEEDKLVPTVCHSLDQA
LEALDADRAFLTKGGVFSDSMLDAYIELKMGEVTRYRQSVHPVEYDMYFSL
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atggcgaagaccgttgcagacgtgatgcagatggtgcaggataacgaggtcaagttcgtg
gacctgcgctttaccgatacccgcggcaaggaacagcacgtgaccgtgcccgtgtcgcac
ttcgacgaggacaagttcgcctcgggccatgctttcgacggttcttccgttgccggctgg
aagggtatcgaagcctcggacatgcagctggttcccgatcccaacactgccaatatcgat
cccttcttcgaagaaaccacactgattctgcagtgcgatgtgatcgaacccggtgatggc
aaggcctacgaccgcgatccccgctccatcgccaagcgtgccgaagcctatctgaaggct
tccggcctgggcgataccgcttacttcggtcccgaacccgaattcttcatcttcgacggc
gtgcgctggggtacagagcctcacaaccccttcttcgaaatcgaagaatacgaggctccc
tggaacaccggcaccaagttcgaaaccggtaaccgtggtcaccgtcctcgcgtcaagggt
ggctacttccccgttcctcctgtcgacagcacccaggacatgcgcgcagagatgtcgctg
ctgctggaggcggtcggcatccctgtcgaagtgttccaccatgaagtggccggcgccggt
cagaacgaaatcggcacacgcttctcgaccctggtcgagcgtgccgactggacacagctg
cagaagtacatcatctggaacgtggccaacacctacggcaagacggcaaccttcatgccc
aagccctacgctggcgataacggctccggcatgcacgtgcaccagtccgtgtggaaggat
ggcaagaacctgtttgccggcgacggctatgccggcctgtccgacttcgccctgtactac
atcggcggcatcatcaagcacgctcgtgcgctgaacgccatcaccaatcccggcaccaac
agctacaagcgtctggttcccggcttcgaagcgcccgtgaagctggcctactcggccaag
aatcgctcggcctccatccgtattccttacgtcagcaatcccaaggctcgtcgcgtggaa
gcccgcttccccgatcctctgatgaacccctacctgggtttcgcagctctgctgatggcc
ggcctggatggcgtggaaaacaagatccatcccggcgaagccgcgaccaaggatctctac
cacctgcctcccgaggaagacaagctggtgcctaccgtctgccacagcctggatcaggct
ctggaagccctggacgccgaccgtgcgttcctgaccaagggcggtgtgttctccgacagc
atgctggatgcctacatcgagctgaagatgggcgaagtgactcgctatcgccagtcggtg
caccctgtcgaatacgatatgtacttctcgctgtaa

DBGET integrated database retrieval system