KEGG   Comamonas testosteroni: CtCNB1_3271Help
Entry
CtCNB1_3271       CDS       T01109                                 

Definition
glutamine synthetase, type I
Orthology
K01915  
glutamine synthetase [EC:6.3.1.2]
Organism
ctt  Comamonas testosteroni CNB-2
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
Glyoxylate and dicarboxylate metabolism
Nitrogen metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Two-component system
Brite
KEGG Orthology (KO) [BR:ctt00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CtCNB1_3271
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    CtCNB1_3271
  Energy metabolism
   00910 Nitrogen metabolism
    CtCNB1_3271
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CtCNB1_3271
   00330 Arginine and proline metabolism
    CtCNB1_3271
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    CtCNB1_3271
Enzymes [BR:ctt01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.1  Acid-D-ammonia (or amine) ligases (amide synthases)
    6.3.1.2  glutamate---ammonia ligase
     CtCNB1_3271
Exosome [BR:ctt04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CtCNB1_3271
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3708494..3709909)
Genome map
AA seq 471 aa AA seqDB search
MAKTVADVMQMVQDNEVKFVDLRFTDTRGKEQHVTVPVSHFDEDKFASGHAFDGSSVAGW
KGIEASDMQLVPDPNTANIDPFFEETTLILQCDVIEPGDGKAYDRDPRSIAKRAEAYLKA
SGLGDTAYFGPEPEFFIFDGVRWGTEPHNPFFEIEEYEAPWNTGTKFETGNRGHRPRVKG
GYFPVPPVDSTQDMRAEMSLLLEAVGIPVEVFHHEVAGAGQNEIGTRFSTLVERADWTQL
QKYIIWNVANTYGKTATFMPKPYAGDNGSGMHVHQSVWKDGKNLFAGDGYAGLSDFALYY
IGGIIKHARALNAITNPGTNSYKRLVPGFEAPVKLAYSAKNRSASIRIPYVSNPKARRVE
ARFPDPLMNPYLGFAALLMAGLDGVENKIHPGEAATKDLYHLPPEEDKLVPTVCHSLDQA
LEALDADRAFLTKGGVFSDSMLDAYIELKMGEVTRYRQSVHPVEYDMYFSL
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atggcgaagaccgttgcagacgtgatgcagatggtgcaggataacgaggtcaagttcgtg
gacctgcgctttaccgatacccgcggcaaggaacagcacgtgaccgtgcccgtgtcgcac
ttcgacgaggacaagttcgcctcgggccatgctttcgacggttcttccgttgccggctgg
aagggtatcgaagcctcggacatgcagctggttcccgatcccaacactgccaatatcgat
cccttcttcgaagaaaccacactgattctgcagtgcgatgtgatcgaacccggtgatggc
aaggcctacgaccgcgatccccgctccatcgccaagcgtgccgaagcctatctgaaggct
tccggcctgggcgataccgcttacttcggtcccgaacccgaattcttcatcttcgacggc
gtgcgctggggtacagagcctcacaaccccttcttcgaaatcgaagaatacgaggctccc
tggaacaccggcaccaagttcgaaaccggtaaccgtggtcaccgtcctcgcgtcaagggt
ggctacttccccgttcctcctgtcgacagcacccaggacatgcgcgcagagatgtcgctg
ctgctggaggcggtcggcatccctgtcgaagtgttccaccatgaagtggccggcgccggt
cagaacgaaatcggcacacgcttctcgaccctggtcgagcgtgccgactggacacagctg
cagaagtacatcatctggaacgtggccaacacctacggcaagacggcaaccttcatgccc
aagccctacgctggcgataacggctccggcatgcacgtgcaccagtccgtgtggaaggat
ggcaagaacctgtttgccggcgacggctatgccggcctgtccgacttcgccctgtactac
atcggcggcatcatcaagcacgctcgtgcgctgaacgccatcaccaatcccggcaccaac
agctacaagcgtctggttcccggcttcgaagcgcccgtgaagctggcctactcggccaag
aatcgctcggcctccatccgtattccttacgtcagcaatcccaaggctcgtcgcgtggaa
gcccgcttccccgatcctctgatgaacccctacctgggtttcgcagctctgctgatggcc
ggcctggatggcgtggaaaacaagatccatcccggcgaagccgcgaccaaggatctctac
cacctgcctcccgaggaagacaagctggtgcctaccgtctgccacagcctggatcaggct
ctggaagccctggacgccgaccgtgcgttcctgaccaagggcggtgtgttctccgacagc
atgctggatgcctacatcgagctgaagatgggcgaagtgactcgctatcgccagtcggtg
caccctgtcgaatacgatatgtacttctcgctgtaa

DBGET integrated database retrieval system