KEGG   Comamonas testosteroni: CtCNB1_3271Help
Entry
CtCNB1_3271       CDS       T01109                                 

Definition
glutamine synthetase, type I
Orthology
K01915  
glutamine synthetase [EC:6.3.1.2]
Organism
ctt  Comamonas testosteroni
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
Glyoxylate and dicarboxylate metabolism
Nitrogen metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Two-component system
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:ctt01230]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:ctt00630]
Metabolism; Energy metabolism; Nitrogen metabolism [PATH:ctt00910]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:ctt00250]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:ctt00330]
Environmental Information Processing; Signal transduction; Two-component system [PATH:ctt02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3708494..3709909)
Genome map
AA seq 471 aa AA seqDB search
MAKTVADVMQMVQDNEVKFVDLRFTDTRGKEQHVTVPVSHFDEDKFASGHAFDGSSVAGW
KGIEASDMQLVPDPNTANIDPFFEETTLILQCDVIEPGDGKAYDRDPRSIAKRAEAYLKA
SGLGDTAYFGPEPEFFIFDGVRWGTEPHNPFFEIEEYEAPWNTGTKFETGNRGHRPRVKG
GYFPVPPVDSTQDMRAEMSLLLEAVGIPVEVFHHEVAGAGQNEIGTRFSTLVERADWTQL
QKYIIWNVANTYGKTATFMPKPYAGDNGSGMHVHQSVWKDGKNLFAGDGYAGLSDFALYY
IGGIIKHARALNAITNPGTNSYKRLVPGFEAPVKLAYSAKNRSASIRIPYVSNPKARRVE
ARFPDPLMNPYLGFAALLMAGLDGVENKIHPGEAATKDLYHLPPEEDKLVPTVCHSLDQA
LEALDADRAFLTKGGVFSDSMLDAYIELKMGEVTRYRQSVHPVEYDMYFSL
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atggcgaagaccgttgcagacgtgatgcagatggtgcaggataacgaggtcaagttcgtg
gacctgcgctttaccgatacccgcggcaaggaacagcacgtgaccgtgcccgtgtcgcac
ttcgacgaggacaagttcgcctcgggccatgctttcgacggttcttccgttgccggctgg
aagggtatcgaagcctcggacatgcagctggttcccgatcccaacactgccaatatcgat
cccttcttcgaagaaaccacactgattctgcagtgcgatgtgatcgaacccggtgatggc
aaggcctacgaccgcgatccccgctccatcgccaagcgtgccgaagcctatctgaaggct
tccggcctgggcgataccgcttacttcggtcccgaacccgaattcttcatcttcgacggc
gtgcgctggggtacagagcctcacaaccccttcttcgaaatcgaagaatacgaggctccc
tggaacaccggcaccaagttcgaaaccggtaaccgtggtcaccgtcctcgcgtcaagggt
ggctacttccccgttcctcctgtcgacagcacccaggacatgcgcgcagagatgtcgctg
ctgctggaggcggtcggcatccctgtcgaagtgttccaccatgaagtggccggcgccggt
cagaacgaaatcggcacacgcttctcgaccctggtcgagcgtgccgactggacacagctg
cagaagtacatcatctggaacgtggccaacacctacggcaagacggcaaccttcatgccc
aagccctacgctggcgataacggctccggcatgcacgtgcaccagtccgtgtggaaggat
ggcaagaacctgtttgccggcgacggctatgccggcctgtccgacttcgccctgtactac
atcggcggcatcatcaagcacgctcgtgcgctgaacgccatcaccaatcccggcaccaac
agctacaagcgtctggttcccggcttcgaagcgcccgtgaagctggcctactcggccaag
aatcgctcggcctccatccgtattccttacgtcagcaatcccaaggctcgtcgcgtggaa
gcccgcttccccgatcctctgatgaacccctacctgggtttcgcagctctgctgatggcc
ggcctggatggcgtggaaaacaagatccatcccggcgaagccgcgaccaaggatctctac
cacctgcctcccgaggaagacaagctggtgcctaccgtctgccacagcctggatcaggct
ctggaagccctggacgccgaccgtgcgttcctgaccaagggcggtgtgttctccgacagc
atgctggatgcctacatcgagctgaagatgggcgaagtgactcgctatcgccagtcggtg
caccctgtcgaatacgatatgtacttctcgctgtaa

DBGET integrated database retrieval system