KEGG   Comamonas testosteroni: CtCNB1_3297Help
Entry
CtCNB1_3297       CDS       T01109                                 

Definition
protein-L-isoaspartate O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
ctt  Comamonas testosteroni
Brite
Enzymes [BR:ctt01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     CtCNB1_3297
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3736556..3737293)
Genome map
AA seq 245 aa AA seqDB search
MQTGTGAARPPVAPKPINPLRVAASPVGVGLDSSTVRARMAQRIGAAGVSNPAVLQAMAT
VERHRFVDSALVNQAYEDTSLPIGLGQTISKPSIVARMIELLLDSDAARNGQGRVLEIGT
GCGYQAAVLSMLTKEVYSVERLRGLHEKARGHLRPMRLSNVHLILGDGMVGFASGAPYAG
IISAAGGDVVPQEWCDQLAVGGRLVAPVVVGAGKQALLVIDKSSHGFTQTVLEAVNFVPL
KSGIA
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
gtgcagacgggcaccggcgcggcacggccgcccgttgctcccaagcccatcaatcccttg
cgtgtggccgcctcgccggtgggcgtggggctggactcatccacggtgcgtgcccgcatg
gcccagcgcatcggtgcggccggcgtcagcaaccctgccgtgctgcaggccatggccacg
gtggagcgtcaccgctttgtcgacagtgctctggtcaatcaggcctacgaagacaccagt
ctgcctatcggcctgggccagaccatctccaagcccagcatcgtggcccgcatgatcgag
ctgctgctcgactccgatgcggcccgcaacgggcaagggcgcgtgctggagatcggcacc
ggttgcggctaccaggcggccgtgctgtccatgcttaccaaagaggtttattcggtagag
cggctgcgtggcctgcacgagaaggcgcgcggtcatctgcgccccatgcgcctgtccaat
gtgcatctgatcctcggtgacggcatggtgggttttgccagtggcgcgccctatgcgggc
atcatctccgctgccggaggtgatgtggtgccgcaagagtggtgtgatcaactggcggtg
ggcgggcgtctggtggctccggtcgtggtgggtgcgggtaagcaggcactgctggtgatt
gacaagagttcacacggttttacgcagacagttttggaagcagtcaactttgtccctcta
aaatcggggatcgcctag

DBGET integrated database retrieval system