KEGG   Comamonas testosteroni CNB-2: CtCNB1_3300Help
Entry
CtCNB1_3300       CDS       T01109                                 

Definition
Twin-arginine translocation pathway signal
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
ctt  Comamonas testosteroni CNB-2
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:ctt00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    CtCNB1_3300
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    CtCNB1_3300
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    CtCNB1_3300
Enzymes [BR:ctt01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     CtCNB1_3300
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3739310..3740917
Genome map
AA seq 535 aa AA seqDB search
MFSPLHAPAPDRRRFLIASSLATAVGALPAWVRATESLAHNPFTLGVASGDPEPDNILIW
TRLTAPLAYLGTAVAPDLAAQTVHWEVAHDAQFRQAVAHGQTQARAEWGHAVHVQVNGLS
PDRWYFYRFRCGDAFSTTARCRTAPAPGADVRKLRLAVASCQRWEHGFYSAWADAAQASP
DLVLFLGDYIYEYAQPAKPDGLARAQPLRTAQTLQDYRDRYALHKSDAHLQAAHAACNWS
VIWDDHEVENDYVAQYGRGDSAHFLARRMAAWQAFYENMPLRDSALQRNFQGMALYRSLQ
WGKLARLHLLDGRQYRDLQACRPEGKASTGTVDPAECPALQDPARSFLGWDQERWLARQL
QGDARERVDATRWSTVVQTTLFSARKHPNGRQSTDSWDGYPQARQRLVRQISESQPRNSV
LLGGDIHQNYVCAIAAQADQAPDRVNRVIASEFCGTSISSHSGTTQARVDAIVAHNPQVL
FARCEERGYSLVDITPQSMTTELRAVSNPLHADSSLYTLARFVVEDRRPGPVKIA
NT seq 1608 nt NT seq  +upstreamnt  +downstreamnt
atgttttctcctcttcacgcgcctgcgccggatcgccggcgctttctgattgcctccagc
cttgccacggccgtgggcgccctgcccgcctgggtccgtgccacggaatcactggcccac
aacccgttcaccctgggagtggccagcggcgacccggagcccgacaacatcctgatctgg
acgcggctgacagcgcctctggcctatctgggcacagcggtcgcgccagacctggcagca
cagaccgtgcattgggaagtggcgcacgatgcccagttccgccaggccgtggcccatggg
cagactcaggccagggccgaatggggccatgccgtccatgtgcaggtcaacggcctgagt
ccggaccgctggtatttctaccgcttccgctgtggcgacgccttcagcaccaccgcacgc
tgccgtaccgccccggcgcccggagcagatgtccgcaagctgcgcctggccgtagcctcc
tgccagcgctgggaacacggcttctacagtgcctgggccgacgccgcgcaggcctcgccc
gatctggtgctgtttctcggtgactacatctatgaatatgcgcagccggccaagcccgat
ggactggcgcgtgcgcagccgctgcgtaccgcccagaccttgcaggactaccgcgaccgc
tatgcgctgcacaaaagcgatgctcatctgcaggccgcccatgccgcgtgcaactggtcc
gtcatctgggacgatcacgaggttgaaaacgactatgtagctcagtacggacgcggggat
agtgctcactttttggctaggcgcatggcggcctggcaggctttctacgaaaacatgccg
ctgcgtgacagcgcattgcagcgcaactttcaaggcatggcgctgtaccgcagcctgcag
tggggcaagctcgccagactgcatctgctggacggccgccagtaccgcgatctgcaggcc
tgccgccccgagggcaaggccagcaccggcaccgtggacccggccgaatgccccgccctg
caagatccggcgcgcagctttctgggttgggatcaggagcgctggctggcccggcagctg
cagggcgatgcacgcgagagggtcgacgccacccgctggagcaccgtggtgcagaccacc
ttgttctcggcccgcaagcatcccaatggcaggcagtccaccgacagctgggacggctac
cctcaggcccgccagcgcctggtgcgccagatttcagaaagccagccgcgcaacagcgtg
ctgctcggcggggacattcaccagaactatgtctgcgccattgcggcccaggccgatcag
gccccggacagggtcaatcgggtaattgccagcgagttctgcggcacctccatcagctcg
cacagcggcaccacacaagccagggtcgatgccatcgtggcccacaaccctcaggtgctt
ttcgcgcgctgcgaggagcgcggctacagcctcgtggatatcacgccgcagtccatgacc
acggagctgcgcgccgtgagcaacccgctccacgccgacagcagcctctatacgctagca
cgctttgtggtcgaggaccgccgccccggtcctgtgaagatcgcctga

DBGET integrated database retrieval system