KEGG   Comamonas testosteroni CNB-2: CtCNB1_3391Help
Entry
CtCNB1_3391       CDS       T01109                                 

Definition
succinate dehydrogenase, cytochrome b subunit
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
ctt  Comamonas testosteroni CNB-2
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:ctt00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CtCNB1_3391
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CtCNB1_3391
   00650 Butanoate metabolism
    CtCNB1_3391
  Energy metabolism
   00190 Oxidative phosphorylation
    CtCNB1_3391
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3836766..3837131
Genome map
AA seq 121 aa AA seqDB search
MSVNYGSKRTVVGAHYGTRDFLAQRSTAVLMALYTVVLLVRFLTVGGPVGYEQWAGIFAP
QWMKFLTLALFVALGWHAWIGVRDIWMDYVKPVGLRLALQVVTIVWLVGCISWGIQVLWR
L
NT seq 366 nt NT seq  +upstreamnt  +downstreamnt
atgtccgtgaattacggctccaagcgcaccgttgtcggtgcgcactatggcacccgcgac
tttctggctcaacgctctaccgccgtcctgatggcgctgtacaccgttgtgctgctggtg
cgctttctgacagtcggcggccccgtgggctacgagcagtgggccggcatttttgctccc
cagtggatgaagtttctgaccctggccctcttcgtggctctgggctggcatgcctggatc
ggcgtgcgtgacatctggatggactacgtcaagcccgtgggcctgcgccttgcactgcaa
gtggtcaccattgtctggctggtcggctgcatcagctggggcatccaggttctgtggcgt
ctctga

DBGET integrated database retrieval system