KEGG   Comamonas testosteroni: CtCNB1_3552Help
Entry
CtCNB1_3552       CDS       T01109                                 

Definition
glycoside hydrolase, family 24
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
ctt  Comamonas testosteroni
Brite
Enzymes [BR:ctt01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     CtCNB1_3552
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4018657..4019127)
Genome map
AA seq 156 aa AA seqDB search
MNWKEKLIATIGGAAAVLAVPLVQKYEGTVLRSYRDPVGIITACTGHTGPELKMGQTYTR
EQCEEMLYKDLAKHADALSCVRAPLTDGQRAAFLSFAFNVGDDAFCRSTLVRKANAGDFG
GACAELSRWIYASGKELPGLVKRRAAERQLCEAGLG
NT seq 471 nt NT seq  +upstreamnt  +downstreamnt
atgaactggaaagaaaaactcattgccactattggcggtgctgccgccgtcctggcggtg
cccctggtgcagaagtacgagggcactgtgctgcgcagctaccgcgacccggtgggcatc
atcacggcctgcaccggccacaccgggcccgagctcaagatgggccagacctacacccgc
gagcaatgcgaggagatgctttacaaggacttggccaagcatgccgacgccctgagctgt
gttcgcgcgccgctgaccgacggccagcgcgcggccttcctaagcttcgcgttcaacgtg
ggggatgacgccttttgccgcagcaccctggtgcgcaaggccaatgcgggcgacttcggc
ggcgcttgcgccgagctgagtcgctggatctatgccagcggcaaggagctgcccggcctg
gtaaagcgccgcgccgcagagcgccaactgtgcgaggcgggcctgggatga

DBGET integrated database retrieval system