KEGG   Comamonas testosteroni CNB-2: CtCNB1_3889Help
Entry
CtCNB1_3889       CDS       T01109                                 

Definition
phosphoglycerate mutase 1 family
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
ctt  Comamonas testosteroni CNB-2
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ctt00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CtCNB1_3889
   01230 Biosynthesis of amino acids
    CtCNB1_3889
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CtCNB1_3889
  Energy metabolism
   00680 Methane metabolism
    CtCNB1_3889
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CtCNB1_3889
Enzymes [BR:ctt01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     CtCNB1_3889
Exosome [BR:ctt04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   CtCNB1_3889
  Exosomal proteins of melanoma cells
   CtCNB1_3889
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4364637..4365380
Genome map
AA seq 247 aa AA seqDB search
MYKLVLIRHGESTWNLENRFTGWTDVDLTATGVEQAKKAGQLLKAEGYDFDVAYTSVLKR
AIRTLWHVQDEMDRTWLPVVHSWRLNERHYGGLQGLNKADMAKQYGDEQVLVWRRSYDVP
PPALEATDPRSERSDVRYAKLQPEQIPLTECLKDTVARVVPFWDESIAPAIKAGKRVVVA
AHGNSIRALIKYLDNIADDQIVGVNVPNGIPLVYELDADLKPIRHYYLGDAEAAAKAAAA
VAAQGKA
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgtacaagctcgttctgatccgccacggtgaatccacctggaaccttgaaaaccgcttc
accggctggaccgatgtggatctgactgccaccggcgtcgaacaggccaagaaggccggc
caactgctcaaggcagaaggctatgacttcgatgtggcctataccagcgtgctcaagcgc
gccatccgtaccctgtggcatgtgcaggatgaaatggaccgcacctggctgcccgtggtg
catagctggcgcctcaacgaacgccactacggcggtctgcaaggtctgaacaaggccgat
atggccaagcagtacggcgacgagcaagtgctggtctggcgccgcagctacgacgtgccg
cctcccgccctggaagccaccgacccccgcagcgaacgcagcgatgtgcgctacgccaag
ctgcagcccgagcagatcccgctgaccgagtgcctcaaggacacggtggcccgcgttgtg
ccgttctgggacgagtccatcgcacccgccatcaaggccggaaaacgggtggttgtggcc
gcacacggcaactccatccgcgccctgatcaagtatctggacaacatcgccgacgaccag
atcgtgggcgtgaacgtgcccaacggcattcctctggtctatgagctggacgccgacctc
aagcccatccgccactactacctgggcgacgccgaagccgcagccaaggctgcagcggca
gttgcggcccagggcaaggcctga

DBGET integrated database retrieval system