KEGG   Comamonas testosteroni: CtCNB1_3980Help
Entry
CtCNB1_3980       CDS       T01109                                 

Definition
aspartate carbamoyltransferase
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
ctt  Comamonas testosteroni
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ctt00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    CtCNB1_3980
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CtCNB1_3980
Enzymes [BR:ctt01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     CtCNB1_3980
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4460274..4461236)
Genome map
AA seq 320 aa AA seqDB search
MLYKRNPQLNKNGELIHLLSTEGLSKDILTQILDTASNFVSVNDREVKKVPLLRGKSVFN
LFFENSTRTRTTFEIAAKRLSADVFNLDIARSSASKGETLLDTIDNLSAMAADIFVVRHS
ESGAPYLIAKHVAPHVHVVNAGDGRHAHPTQGLLDMYTIRHYKQDFSNLRVAIVGDVLHS
RVARSDIHALTTLGAAEVRVVGPRTLVPSDMASMGVRVFHNLEEGIKDCDVIIMLRLQNE
RMSGALLPSSQEYFKSFGLTEKRLELAKPDAIVMHPGPINRGVEIDSAVVDGPQAVILSQ
VTFGIAVRMAVMSIVAGNEA
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
gtgctgtacaagcgcaacccccaactcaacaagaacggcgagctgatccacctgctctcc
accgaaggcctgtccaaggacatcctgacccagattctcgacacggccagcaacttcgtc
agcgtcaacgaccgtgaagtcaagaaggtgcctctgctgcgtggcaagagcgtgttcaat
ctgttcttcgagaacagcacgcgtacccgcaccaccttcgagattgcggccaagcgcctg
tcggccgacgtcttcaacctggacatcgcgcgcagctcggccagcaagggcgagaccctg
ctggacaccatcgacaacctctcggccatggcggccgacatctttgtcgtgcgccacagc
gagtcgggcgctccctatctgatcgccaaacatgtggcgccccatgtgcatgtggtcaat
gccggcgacggccgccatgcccaccccacccagggtctgctggacatgtacaccatccgc
cactacaagcaggatttctccaatctgcgcgtggccatcgtgggcgacgtgctgcactcg
cgcgtggcgcgctcggacatccacgccctgaccacactcggcgctgccgaggtgcgcgtg
gtcggcccgcgtaccctggtgccctcggacatggccagcatgggtgtgcgcgtcttccac
aatctggaggaaggcatcaaggactgcgacgtcatcatcatgctgcgtctgcagaacgag
cgcatgagtggcgcgctgctgccttcgagccaggaatacttcaagagcttcggcctgacc
gaaaagcgcctggagctggccaagcccgatgccatcgtcatgcaccccggccccatcaac
cgcggcgtggagatcgactccgccgtggtggatggcccgcaggccgtgatcctgtcgcag
gtgaccttcggtatcgccgtgcgcatggcggtcatgtcgatcgtcgcgggtaacgaagcc
tga

  All links  
No link information was found.   
DBGET integrated database retrieval system