KEGG   Comamonas testosteroni CNB-2: CtCNB1_4054Help
Entry
CtCNB1_4054       CDS       T01109                                 

Definition
thiol:disulfide interchange protein DsbC
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
ctt  Comamonas testosteroni CNB-2
Brite
Enzymes [BR:ctt01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     CtCNB1_4054
Secretion system [BR:ctt02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   CtCNB1_4054
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4554024..4554731
Genome map
AA seq 235 aa AA seqDB search
MKLVACLLATASLTFGLSVHAQDANLKKTLTERIPQLEKIDEVRSTPMSGLYEVRVGTDI
FYTDAKGNYLIQGELIDTKARRNLTEDRMTQLTAVDFKQLPIKDAITIVHGKGERKMAVF
EDPNCGYCKRFEKDLQSVDNVTIYLFLYPILSPDSAEKSRNIWCAKDQAKAWHEQMLNSK
NAPAAQCDPAAIQRNLAFGRKYKITGTPTVIFSNNVRVPGAISAAEVEKHLAAAK
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atgaaacttgttgcctgcctgctggccaccgccagcctgaccttcggcctgagcgtgcat
gcccaggatgccaacctcaagaagacgctgaccgagcgcattccccagctcgagaaaatc
gacgaggtgcgctccacccccatgagcggcctgtacgaagtacgcgtgggcacggacatc
ttctacaccgatgccaagggcaactatctgattcaaggcgagctcatcgacaccaaggcg
cgccgcaatctgaccgaagaccgcatgacccagctcacggccgtggacttcaaacagttg
cccatcaaggacgccatcaccatcgtgcatggcaagggcgagcgcaagatggccgtgttt
gaagacccgaactgcggctactgcaagcgcttcgaaaaagacctgcaaagcgtggacaac
gtcaccatctacctcttcctctaccccatcctgagcccggactcggccgagaagtcgcgc
aatatctggtgcgccaaggatcaggccaaggcctggcatgagcagatgctgaacagcaag
aacgcaccagccgcccagtgcgaccccgccgccatccagcgcaatctggctttcggccgc
aagtacaagatcaccggcacgcccaccgtgattttttccaacaatgtgcgtgtgcccggc
gccatctcggctgccgaggtcgaaaagcacctggccgccgccaagtaa

DBGET integrated database retrieval system