KEGG   Comamonas testosteroni CNB-2: CtCNB1_4056Help
Entry
CtCNB1_4056       CDS       T01109                                 

Definition
(GenBank) Enoyl-CoA hydratase/isomerase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
ctt  Comamonas testosteroni CNB-2
Pathway
ctt00071  Fatty acid degradation
ctt00280  Valine, leucine and isoleucine degradation
ctt00281  Geraniol degradation
ctt00310  Lysine degradation
ctt00360  Phenylalanine metabolism
ctt00362  Benzoate degradation
ctt00380  Tryptophan metabolism
ctt00410  beta-Alanine metabolism
ctt00627  Aminobenzoate degradation
ctt00640  Propanoate metabolism
ctt00650  Butanoate metabolism
ctt00903  Limonene and pinene degradation
ctt00930  Caprolactam degradation
ctt01100  Metabolic pathways
ctt01110  Biosynthesis of secondary metabolites
ctt01120  Microbial metabolism in diverse environments
ctt01130  Biosynthesis of antibiotics
ctt01212  Fatty acid metabolism
Module
ctt_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:ctt00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    CtCNB1_4056
   00650 Butanoate metabolism
    CtCNB1_4056
  Lipid metabolism
   00071 Fatty acid degradation
    CtCNB1_4056
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CtCNB1_4056
   00310 Lysine degradation
    CtCNB1_4056
   00360 Phenylalanine metabolism
    CtCNB1_4056
   00380 Tryptophan metabolism
    CtCNB1_4056
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CtCNB1_4056
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    CtCNB1_4056
   00281 Geraniol degradation
    CtCNB1_4056
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CtCNB1_4056
   00627 Aminobenzoate degradation
    CtCNB1_4056
   00930 Caprolactam degradation
    CtCNB1_4056
Enzymes [BR:ctt01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     CtCNB1_4056
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2 Peptidase_S49
Motif
Other DBs
NCBI-ProteinID: ACY34802
UniProt: D0J6T5
Position
4556740..4557519
Genome map
AA seq 259 aa AA seqDB search
MAYETIEVRVEADKVGVITLNRPKQLNALNDQLMDELGDALRKFDADKSIGCMIITGSER
AFAAGADIGAMAKYSFADAYGGDYITRNWETIRSIRKPVIAAVSGFALGGGCELAMMCDF
IIAADNAKFGQPEIKLGVIPGAGGTQRLPRAVGKSKAMDMALTARMMDASEAERAGLVSR
VVPFDKLMEEALGAAIIISGFSQLAVMAAKESVNRAFESGLSDGVMFERRLFHALFATQD
QKEGMDAFVNKRPANFTHQ
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
ttggcctacgaaactatcgaagtccgcgtggaagcggacaaagtcggcgtcatcacgctg
aaccgtcccaagcagctcaatgccctgaacgaccagctcatggacgaactgggcgatgcg
ctcaggaagttcgatgccgacaaaagcattggctgcatgatcatcaccggcagcgaacgc
gcctttgccgccggtgccgacatcggtgccatggccaagtacagctttgccgacgcctat
ggcggcgactacatcacgcgcaactgggaaaccattcgcagcatccgcaagcccgtgatt
gccgccgtcagcggctttgccctgggcggcggctgcgagctggcgatgatgtgcgacttc
atcatcgctgccgataacgccaagttcggccagcccgagatcaagctgggcgtgattcct
ggtgccggcggtacgcagcgcctgccgcgtgccgtgggcaaatccaaggccatggacatg
gctctgaccgcccgcatgatggatgccagcgaggccgagcgcgccggcctggtcagccgc
gtcgtgccttttgacaagctgatggaagaagctctgggtgcggccatcatcatcagcggc
ttctcccagctggccgtgatggctgccaaggaatccgtgaaccgtgcattcgagagcggc
ctgtccgatggcgtgatgttcgagcgccgcctgttccatgccctgtttgccacccaggac
cagaaggaaggcatggacgcgtttgtgaacaagcgccccgctaacttcacccaccagtaa

DBGET integrated database retrieval system