KEGG   Comamonas testosteroni: CtCNB1_4119Help
Entry
CtCNB1_4119       CDS       T01109                                 

Definition
UDP-N-acetylmuramyl-tripeptide synthetase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
ctt  Comamonas testosteroni
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:ctt00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:ctt00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4625509..4627014)
Genome map
AA seq 501 aa AA seqDB search
MSTPIQILNNAAEAVAWLRSRVQGDLQTDSRKVKAGDAFVAWPGAATDGRAYVGKALEQG
AAALLVEADGLQAFDLSGDSIAALKGLKAATGLIADQWFAHPSGELDVLAVTGTNGKTTT
AWWLAHALSKVTLNTRTGCALVGTLGVGVPPALESTGMTTPDPVLLQRAFRSYADQGLAA
CAIEASSIGIVEHRLDGSKIRVALFTNFTQDHLDYHGSMDAYWQAKAQLFDWPGLPAAVV
NIDDAHGARLWARLQGRAMDVWSVSIQGPARLQAKDIGLGDEGLSFTVLEAGHSLRMNTR
LVGQYNVSNLLGVLATLRCLGLTLEQAVQACADLEPVPGRMQQIVKPGQPLVAVDYAHTP
DALEKALRALQPAARQRQGKLWCVFGCGGDRDNSKRPLMGQAAQAHADGVFVTSDNPRSE
VPESIIDQILAGMQAGQALHVQADRAAAIAQAIARADARDVVLIAGKGHEDYQETKGVRH
PFSDMAEAQKALAAREGKIRS
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgagcacccccattcaaatcctgaacaatgcagccgaggccgttgcctggctgcgcagt
cgcgtgcagggtgacctgcagaccgatagccgcaaggtcaaggccggcgatgcctttgtc
gcctggcccggtgctgccactgatggccgagcctatgtgggcaaggctctggagcagggc
gccgccgccttgctggtggaggccgatggtctgcaggccttcgatctgagcggcgacagc
attgcagctctcaagggcctgaaggccgcgacgggactgattgccgaccaatggtttgca
catcccagtggcgagctcgacgtgctggccgtgaccggcaccaacggcaagaccaccaca
gcctggtggctggcgcatgcgctctcgaaagtgacgctgaacacacgcaccggctgtgcg
ctggtgggcaccctgggtgtgggcgtgccgcctgcattggagtcgacaggcatgaccacg
ccggacccggtgttgctgcagcgcgcgttccgcagctacgccgaccagggtcttgccgcc
tgtgccatcgaggcatcgtccatcggcatcgtcgagcaccgtctggacggcagcaagatt
cgcgtggcgttgttcaccaatttcacgcaggaccacctggactaccacggcagcatggat
gcctactggcaggccaaggcccaactgttcgactggcccggcctgccggccgccgtggtc
aatatcgacgatgcgcatggcgccaggctctgggccaggctgcaaggccgcgccatggat
gtgtggagcgtctccatccagggaccggctcgcctgcaggccaaggacatcggtctgggc
gacgagggtctgagctttaccgtgctggaagccggtcacagcctgcgcatgaatacgcgt
ctggtcggtcagtacaacgtctccaatctgctcggggtgctggccaccctgcgctgcctg
ggcctgacgctggagcaggccgtgcaggcctgcgccgatctggagcccgtgcccggtcgc
atgcagcagatcgtcaagcccggtcagcctctggtggccgtggactatgcccatacgcct
gatgcgctggaaaaagccttgcgcgcgctgcagcccgccgcgcggcagcgccagggcaag
ctgtggtgcgtgttcggctgcggcggcgaccgggacaacagcaagcgtccgctgatgggg
caggccgcccaggcgcatgccgacggcgttttcgtcaccagcgacaacccgcgcagtgaa
gtgcccgaaagcatcatcgaccagatcctggccggcatgcaggcgggccaggcattgcat
gttcaggccgaccgcgcggcggccattgcccaagccattgcccgtgccgatgcgcgcgac
gtggtgctgattgccggcaagggacatgaggactatcaggagacgaagggcgtgcgccat
ccgttctccgacatggctgaggcgcagaaggcgctcgcagcccgcgaaggaaagatccgg
tcatga

DBGET integrated database retrieval system