KEGG   Comamonas testosteroni CNB-2: CtCNB1_4119Help
Entry
CtCNB1_4119       CDS       T01109                                 

Definition
UDP-N-acetylmuramyl-tripeptide synthetase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
ctt  Comamonas testosteroni CNB-2
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:ctt00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    CtCNB1_4119
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    CtCNB1_4119
Enzymes [BR:ctt01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     CtCNB1_4119
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4625509..4627014)
Genome map
AA seq 501 aa AA seqDB search
MSTPIQILNNAAEAVAWLRSRVQGDLQTDSRKVKAGDAFVAWPGAATDGRAYVGKALEQG
AAALLVEADGLQAFDLSGDSIAALKGLKAATGLIADQWFAHPSGELDVLAVTGTNGKTTT
AWWLAHALSKVTLNTRTGCALVGTLGVGVPPALESTGMTTPDPVLLQRAFRSYADQGLAA
CAIEASSIGIVEHRLDGSKIRVALFTNFTQDHLDYHGSMDAYWQAKAQLFDWPGLPAAVV
NIDDAHGARLWARLQGRAMDVWSVSIQGPARLQAKDIGLGDEGLSFTVLEAGHSLRMNTR
LVGQYNVSNLLGVLATLRCLGLTLEQAVQACADLEPVPGRMQQIVKPGQPLVAVDYAHTP
DALEKALRALQPAARQRQGKLWCVFGCGGDRDNSKRPLMGQAAQAHADGVFVTSDNPRSE
VPESIIDQILAGMQAGQALHVQADRAAAIAQAIARADARDVVLIAGKGHEDYQETKGVRH
PFSDMAEAQKALAAREGKIRS
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgagcacccccattcaaatcctgaacaatgcagccgaggccgttgcctggctgcgcagt
cgcgtgcagggtgacctgcagaccgatagccgcaaggtcaaggccggcgatgcctttgtc
gcctggcccggtgctgccactgatggccgagcctatgtgggcaaggctctggagcagggc
gccgccgccttgctggtggaggccgatggtctgcaggccttcgatctgagcggcgacagc
attgcagctctcaagggcctgaaggccgcgacgggactgattgccgaccaatggtttgca
catcccagtggcgagctcgacgtgctggccgtgaccggcaccaacggcaagaccaccaca
gcctggtggctggcgcatgcgctctcgaaagtgacgctgaacacacgcaccggctgtgcg
ctggtgggcaccctgggtgtgggcgtgccgcctgcattggagtcgacaggcatgaccacg
ccggacccggtgttgctgcagcgcgcgttccgcagctacgccgaccagggtcttgccgcc
tgtgccatcgaggcatcgtccatcggcatcgtcgagcaccgtctggacggcagcaagatt
cgcgtggcgttgttcaccaatttcacgcaggaccacctggactaccacggcagcatggat
gcctactggcaggccaaggcccaactgttcgactggcccggcctgccggccgccgtggtc
aatatcgacgatgcgcatggcgccaggctctgggccaggctgcaaggccgcgccatggat
gtgtggagcgtctccatccagggaccggctcgcctgcaggccaaggacatcggtctgggc
gacgagggtctgagctttaccgtgctggaagccggtcacagcctgcgcatgaatacgcgt
ctggtcggtcagtacaacgtctccaatctgctcggggtgctggccaccctgcgctgcctg
ggcctgacgctggagcaggccgtgcaggcctgcgccgatctggagcccgtgcccggtcgc
atgcagcagatcgtcaagcccggtcagcctctggtggccgtggactatgcccatacgcct
gatgcgctggaaaaagccttgcgcgcgctgcagcccgccgcgcggcagcgccagggcaag
ctgtggtgcgtgttcggctgcggcggcgaccgggacaacagcaagcgtccgctgatgggg
caggccgcccaggcgcatgccgacggcgttttcgtcaccagcgacaacccgcgcagtgaa
gtgcccgaaagcatcatcgaccagatcctggccggcatgcaggcgggccaggcattgcat
gttcaggccgaccgcgcggcggccattgcccaagccattgcccgtgccgatgcgcgcgac
gtggtgctgattgccggcaagggacatgaggactatcaggagacgaagggcgtgcgccat
ccgttctccgacatggctgaggcgcagaaggcgctcgcagcccgcgaaggaaagatccgg
tcatga

DBGET integrated database retrieval system