KEGG   Comamonas testosteroni: CtCNB1_4132Help
Entry
CtCNB1_4132       CDS       T01109                                 

Definition
diaminopimelate epimerase
Orthology
K01778  
diaminopimelate epimerase [EC:5.1.1.7]
Organism
ctt  Comamonas testosteroni
Pathway
Lysine biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:ctt00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CtCNB1_4132
  Amino acid metabolism
   00300 Lysine biosynthesis
    CtCNB1_4132
Enzymes [BR:ctt01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.7  diaminopimelate epimerase
     CtCNB1_4132
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4638771..4639661)
Genome map
AA seq 296 aa AA seqDB search
MCGIMQIRFTKMQGAGNDFVVLDETQARLGLSTAQYRYLANRHFGVGADQILTVRPAPAE
GVDFEYVIHNADGGEVEQCGNGARCFARYVHDKGLTDKSVIRVQTLSGVIAPEIHGNGRV
TVDMGAPQLDPAKVPFTNDGLQAETLGSTQKWPLTLDTPLQPATVWIAAVSMGNPHAVQL
VDDVDAALVGLHGPLIENHARFPQRVNAGFMQILNRSEVRLRVYERGAGETLACGTGACA
AVVAGIGWGLLDQRVDVHTRGGLLTIEWTGGAHDRVRMTGPAEFVFEGQIDIPDTL
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggcatcatgcagattcgctttaccaagatgcaaggtgcgggcaacgactttgtc
gtgctcgacgaaacccaggctcgcctgggcttgagcaccgcccagtaccgctacctggcc
aatcgtcactttggcgtgggcgccgaccagatcctgacggtgcgcccggcacccgcagag
ggcgtggactttgaatatgtgatccacaacgccgacggtggcgaggtcgagcagtgcgga
aacggcgcacgctgttttgcgcgctatgtgcatgacaagggtctgaccgacaagagcgtg
atccgcgtacagaccctctcgggcgtcatcgcccccgaaattcatggcaatggccgcgtc
acggtcgatatgggtgcgcctcagctggatccggccaaggtgccgttcacgaacgacggt
ctgcaggccgagactctgggttcgacgcaaaaatggcctctgacgcttgatactcctttg
cagccggctacagtctggatagcagccgtttccatgggcaatccgcatgcggtgcagttg
gtggacgatgtggatgccgctttggtggggttgcacggcccgctgatagagaaccatgcc
cgttttcctcagcgtgtgaacgccggcttcatgcagatcctcaaccgcagtgaagtccgc
ttgcgtgtctatgaacgtggtgccggcgagaccctggcctgcggtacgggggcttgtgcc
gccgtggtggccggcattggctggggcctgctcgatcagcgcgtcgatgttcatacccgc
ggcggtctgctgaccattgaatggactggcggtgcgcacgatcgcgtgcgcatgaccggc
cctgccgaatttgtttttgaaggccagatcgacatacctgataccttatga

DBGET integrated database retrieval system