KEGG   Comamonas testosteroni CNB-2: CtCNB1_4132Help
Entry
CtCNB1_4132       CDS       T01109                                 

Definition
(GenBank) diaminopimelate epimerase
  KO
K01778  diaminopimelate epimerase [EC:5.1.1.7]
Organism
ctt  Comamonas testosteroni CNB-2
Pathway
ctt00300  Lysine biosynthesis
ctt01100  Metabolic pathways
ctt01110  Biosynthesis of secondary metabolites
ctt01120  Microbial metabolism in diverse environments
ctt01130  Biosynthesis of antibiotics
ctt01230  Biosynthesis of amino acids
Module
ctt_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:ctt00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    CtCNB1_4132
Enzymes [BR:ctt01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.7  diaminopimelate epimerase
     CtCNB1_4132
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAP_epimerase
Motif
Other DBs
NCBI-ProteinID: ACY34878
UniProt: D0J7E6
Position
complement(4638771..4639661)
Genome map
AA seq 296 aa AA seqDB search
MCGIMQIRFTKMQGAGNDFVVLDETQARLGLSTAQYRYLANRHFGVGADQILTVRPAPAE
GVDFEYVIHNADGGEVEQCGNGARCFARYVHDKGLTDKSVIRVQTLSGVIAPEIHGNGRV
TVDMGAPQLDPAKVPFTNDGLQAETLGSTQKWPLTLDTPLQPATVWIAAVSMGNPHAVQL
VDDVDAALVGLHGPLIENHARFPQRVNAGFMQILNRSEVRLRVYERGAGETLACGTGACA
AVVAGIGWGLLDQRVDVHTRGGLLTIEWTGGAHDRVRMTGPAEFVFEGQIDIPDTL
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggcatcatgcagattcgctttaccaagatgcaaggtgcgggcaacgactttgtc
gtgctcgacgaaacccaggctcgcctgggcttgagcaccgcccagtaccgctacctggcc
aatcgtcactttggcgtgggcgccgaccagatcctgacggtgcgcccggcacccgcagag
ggcgtggactttgaatatgtgatccacaacgccgacggtggcgaggtcgagcagtgcgga
aacggcgcacgctgttttgcgcgctatgtgcatgacaagggtctgaccgacaagagcgtg
atccgcgtacagaccctctcgggcgtcatcgcccccgaaattcatggcaatggccgcgtc
acggtcgatatgggtgcgcctcagctggatccggccaaggtgccgttcacgaacgacggt
ctgcaggccgagactctgggttcgacgcaaaaatggcctctgacgcttgatactcctttg
cagccggctacagtctggatagcagccgtttccatgggcaatccgcatgcggtgcagttg
gtggacgatgtggatgccgctttggtggggttgcacggcccgctgatagagaaccatgcc
cgttttcctcagcgtgtgaacgccggcttcatgcagatcctcaaccgcagtgaagtccgc
ttgcgtgtctatgaacgtggtgccggcgagaccctggcctgcggtacgggggcttgtgcc
gccgtggtggccggcattggctggggcctgctcgatcagcgcgtcgatgttcatacccgc
ggcggtctgctgaccattgaatggactggcggtgcgcacgatcgcgtgcgcatgaccggc
cctgccgaatttgtttttgaaggccagatcgacatacctgataccttatga

DBGET integrated database retrieval system