KEGG   Comamonas testosteroni: CtCNB1_4178Help
Entry
CtCNB1_4178       CDS       T01109                                 

Definition
arginase
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
ctt  Comamonas testosteroni
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ctt00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CtCNB1_4178
  Amino acid metabolism
   00330 Arginine and proline metabolism
    CtCNB1_4178
Enzymes [BR:ctt01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     CtCNB1_4178
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4695246..4696199
Genome map
AA seq 317 aa AA seqDB search
MACTSSTLIGLPTDIGASRLGAAMGPDALRVAQLGPALQRLGVQVSDLGNLSGPANPRGA
RDAQGLRNLAECLSWNRIAHDAVLQVLQQHRLPILLGGDHTLATGSISAVARHCRATGKQ
LRVLWLDAHSDCNTPESSPTGNLHGMPVSSLCGLGPAELASLSGTTPALPASSFCQIGLR
SVDESEKHMIRELGLEVYDMRAIDELGMREVMRRALVSLLGRNDRDIHLHLSFDVDFLDP
DIAPGTGTPVRGGPTYREAQLCMEMIADSGRLASLDIVELNPALDLRNQTAELVVDLVQS
LFGQSTLMREPRGVLQC
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atggcatgcacatcgtccacactgatcggtctgcccaccgatatcggtgcctcgcgcctt
ggcgcggccatggggcccgatgccctgcgtgtggcccagctcggtccggcgctgcaacgg
ctgggtgtgcaggtcagcgatctgggcaatctgagcggccccgccaacccgcgtggcgcg
cgcgatgcccagggtctgcgcaatctggccgaatgcctgagctggaaccggatcgcccat
gacgcggtgctgcaggtgctgcagcaacaccggctgcccatactgctgggtggcgaccat
acgctggccacaggctccatcagcgccgtggcccgccattgccgcgccacgggcaagcag
ctgcgcgtgctctggctggatgcccactcggattgcaacacccccgaaagttcgcccacg
ggcaatctgcacggcatgccggtttcaagcctctgcggactgggaccggcggaactggcc
tcgctgtcgggcacgactcccgccctgcctgcctcatcgttctgccagatcggcctgcgc
agcgtggacgagagcgaaaagcacatgatccgagagctggggctggaggtctacgacatg
cgggccattgacgagctgggcatgcgtgaagtgatgcgccgcgccctggtcagcctgctg
ggacgcaacgacagagacatccatctgcatctgagctttgacgtggactttctcgatcct
gacattgctcccggcaccggcacgccggtacgcggcggccccacctaccgcgaggcccag
ctgtgcatggaaatgattgccgactccggccgtcttgcctcgctggacattgtggagctc
aacccggcgctggacctgcgcaaccagacggcggagctggtggtggatctggtgcaaagc
ctgttcgggcagagcacgctgatgcgcgagcctcgcggcgtgctgcaatgctga

  All links  
No link information was found.   
DBGET integrated database retrieval system