KEGG   Comamonas testosteroni CNB-2: CtCNB1_4447Help
Entry
CtCNB1_4447       CDS       T01109                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
ctt  Comamonas testosteroni CNB-2
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ctt00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    CtCNB1_4447
Enzymes [BR:ctt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     CtCNB1_4447
Exosome [BR:ctt04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CtCNB1_4447
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4986875..4988371
Genome map
AA seq 498 aa AA seqDB search
MTTYLLALDQGTSSSRSIVFDTQGRIVASAQLELPQIYPQPGWVEHDPREIWRTQLSTAK
EALAKAGLKAGDIRSVGITNQRETTIVWNRKTGAPIHHGIVWQDRRAEPTCVQLREAGQS
DVILQKTGLRIDAYFSGTKLKWLLDHVPGARAAAQAGELAFGTVDCWLIWQLTGGKRHVT
DVSNASRTMLFNVHSNQWDADLLALLDIPAGLMPEVLPSAADFGQTADEVLGGSIKIGGV
AGDQQSALFGQACFDAGMAKNTYGTGCFMLMHTGSSFQTSSNGLLTTSAAQAGSQPQFAL
EGSVFVGGAVVQWLRDGLQAIEHSGQVQQLAESVPDSGGVMLVPAFTGLGAPYWKPDARG
TITGLTRGTTMAHIARAALESIAYQSAALLGAMSRDAVATGGTPVSELRVDGGACVNNLL
MQFQADLLGIPVVRPACVETTALGAAYLAGLSSGVYQSTEELSALWKAERRFLPTLGKDR
ADELMQRWEQAVRQTTAQ
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgacaacctatctgctcgccctggaccagggcacctccagctcccgctccatcgtcttc
gacacgcaaggccgcatcgtggcatcggcccagctggagctgccgcagatctacccgcag
ccgggctgggtggagcatgacccgcgcgagatctggcgcacccagctgagcaccgccaag
gaggcgctggccaaggcgggcctcaaggctggcgatatccgctcggtgggcattaccaac
cagcgcgagaccaccatcgtctggaaccgcaagaccggcgcgcccattcaccatggcatc
gtatggcaggaccgccgcgccgagcccacctgcgtgcagctgcgcgaagccggtcaaagc
gacgtgattctgcagaaaaccggcctgcgcatcgatgcctatttctcaggcaccaagctc
aagtggctgctggaccatgtgcccggcgcacgcgccgcagcgcaggccggcgagctggcc
ttcggcacggtggattgctggctgatctggcaactgacgggcggcaagcgccatgtcacc
gatgtgagcaatgccagccgcaccatgctcttcaatgtgcacagcaaccagtgggacgcc
gatcttctggccctgctcgacattcccgcgggcctgatgcccgaagtcctgccctcggcc
gccgatttcggccagacagccgacgaggtgctgggcggctccatcaagatcggcggcgtg
gccggcgaccagcaaagtgcgctgttcggccaggcctgcttcgacgccggcatggccaag
aacacctatggcacgggttgcttcatgctcatgcatacgggcagcagcttccagacctcg
agcaacggcctgctgaccacatcggccgcccaggcgggcagccagccccagtttgcgctg
gaaggcagcgtcttcgtcggcggtgccgtggtgcagtggctgcgcgacggcctgcaggcc
atcgagcacagcggccaggtgcagcaactggccgaaagcgtgcccgacagcggcggcgtg
atgctggtgcccgcttttaccggcctgggcgccccctactggaagcccgatgcgcgcggc
accatcaccgggctgacgcgcggcacgacgatggcccatatcgctcgcgcggccctggag
tccattgcctaccagagtgcggccctgctcggcgccatgagccgcgacgccgtggccacg
ggcggcacgccggtcagcgagctgcgcgtggacggcggtgcctgcgtgaacaatctgctg
atgcagttccaggccgacctgctgggcattcccgtggtgcgcccggcctgcgtggaaacc
acggccctgggggcagcctatctggccggcctgtccagcggcgtctatcagagcaccgag
gagctgtcggcattgtggaaggccgagcgccgcttcctgcccacgctgggcaaggaccgc
gccgacgagctgatgcagcgctgggaacaggccgtgcgccagaccacggcgcagtaa

DBGET integrated database retrieval system