KEGG   Comamonas testosteroni CNB-2: CtCNB1_4463Help
Entry
CtCNB1_4463       CDS       T01109                                 

Definition
(GenBank) Indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
ctt  Comamonas testosteroni CNB-2
Pathway
ctt00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ctt01100  Metabolic pathways
ctt01110  Biosynthesis of secondary metabolites
ctt01130  Biosynthesis of antibiotics
ctt01230  Biosynthesis of amino acids
Module
ctt_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ctt00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CtCNB1_4463
Enzymes [BR:ctt01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     CtCNB1_4463
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS QRPTase_C
Motif
Other DBs
NCBI-ProteinID: ACY35209
UniProt: D0IVX3
Position
complement(5003119..5003919)
Genome map
AA seq 266 aa AA seqDB search
MSDILKKICDVKVQEVAAAKKAVPFAEMRRDAQSRVSTRDFVGAIRAKIAKGQAGVIAEV
KKASPSKGVIRPDFDPADIAQSYMVGDGKISAACLSVLTDRQFFQGQPDYLKQARASTLL
PVLRKDFMVDPYQIYESRVMGADCVLLIAACLDDAQMAEMEQIAHSLDMDVLVEVHDGEE
LQRALKLKTPLVGINNRNLRTFEVDIQTTIALKKDVPADRLLVTESGILSRDDVKTMRDA
GIDAFLVGEAFMRAREPGEALAQLFQ
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgtctgacattctcaagaaaatctgcgacgtcaaggtccaggaagttgctgccgccaag
aaggccgtgccgtttgccgagatgcgccgcgatgcgcaaagccgtgtctccacgcgcgat
ttcgtgggcgccatccgtgccaagattgccaagggacaggccggtgtgatcgccgaagtc
aagaaggccagtcccagcaagggcgtgatccgtcccgacttcgatcctgccgacatcgcc
cagagctatatggtgggcgacggcaagatcagtgcggcctgcctgtcggtgctgaccgat
cgccagttcttccaggggcaaccagactatctcaagcaggcccgcgcgagcacgctgctg
ccggtgctgcgcaaggacttcatggtcgacccctatcagatctacgaatcgcgggtgatg
ggcgccgactgcgtgctcttgatcgccgcctgcctggatgatgcgcagatggcggagatg
gagcagattgcgcacagcctggacatggatgtgctggtggaagtgcatgacggcgaggag
ttgcagcgcgctctcaagctcaagacgccgctggtgggcatcaacaaccgcaatctgcgc
acattcgaggtcgatattcagaccacgattgccctcaagaaggatgtccctgccgatcgc
ctgctggtgaccgagtccggcatcctgagccgcgacgatgtgaagaccatgcgtgacgcc
ggcattgacgccttcctggtgggcgaggcttttatgcgtgcccgcgagccgggcgaggcc
ctggcccagttgtttcagtga

DBGET integrated database retrieval system