KEGG   Comamonas testosteroni CNB-2: CtCNB1_4550Help
Entry
CtCNB1_4550       CDS       T01109                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
ctt  Comamonas testosteroni CNB-2
Pathway
ctt00620  Pyruvate metabolism
ctt00630  Glyoxylate and dicarboxylate metabolism
ctt01100  Metabolic pathways
ctt01110  Biosynthesis of secondary metabolites
ctt01120  Microbial metabolism in diverse environments
ctt01200  Carbon metabolism
Module
ctt_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:ctt00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    CtCNB1_4550
   00630 Glyoxylate and dicarboxylate metabolism
    CtCNB1_4550
Enzymes [BR:ctt01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     CtCNB1_4550
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase YqaJ
Motif
Other DBs
NCBI-ProteinID: ACY35296
UniProt: D0IW61
Position
5092368..5094560
Genome map
AA seq 730 aa AA seqDB search
MTDRTQVHGLQVATELYNFVNTQVLPGTGVDQDTYWKGFDAIVADLAPKNAALLAERDSL
QTQLDTWHKANPGPIADMAAYRQFLTSIGYLVESPKDAKATTENVDAELAIQAGPQLVVP
ILNARYALNAANARWGSLYDALYGTDAISEEGGAEKGKGYNPVRGAKVIAFARNFLDQAV
PLASGSHKDSTGYAVEGGKLVVSLKDGSKTGLKDEAKFIGYQGDAAAPKSVLLKNNGIHI
DIIINKSTPIGSTDAAGVADVVVEAALSTILDLEDSVAAVDAEDKVNGYANWLGILKGTL
TESFEKGGKTVTRGLNPDREYTGADGKPVKLHGRSLMFVRNVGHLMTNPAVLWGPEQKEI
PEGIMDALVTTAIAIHDLKGNGANGIRNSRTGSVYIVKPKMHGPAEAAFANELFGRVEKV
LGLPENTVKLGIMDEERRTSTNLKAAIAAAPARVAFINTGFLDRTGDEMHTAMYAGPMVR
KADMKTCAWLPAYEKNNVLVGLNMGLRGRAQIGKGMWAMPDLMKAMLEQKIAQPKAGANT
AWVPSPTGATLHALHYHQINVAEVQKGLESPNADAECDELLNAILQVPVSTNPNWSDVEK
QQEVDNNVQGILGYVVRWIDQGVGCSKVPDIHNVGLMEDRATLRISSQHIANWLQHGIVT
EAMVRDSYARMAKIVDEQNAGDAAYKSLVANPDGAAYQAALDLVFKGKEQPSGYTEPLLH
AWRLKVKAGA
NT seq 2193 nt NT seq  +upstreamnt  +downstreamnt
atgactgatcgcacccaagtccacggcctgcaagtcgccaccgagctgtacaactttgtg
aacacgcaagtgctgcctggcacgggcgtggaccaggacacctactggaagggcttcgac
gccatcgtggccgatctggcgcccaagaacgcagccctgctggccgagcgcgatagcctg
cagacgcagctcgatacctggcacaaggccaaccccggccccatcgccgacatggcggcc
taccgccagtttctgaccagcatcggctatctggtggagtctcccaaggacgccaaggcc
acgaccgaaaacgtcgacgccgaactggccattcaggccggcccccagctggtggtgccc
attctgaacgcccgctacgcgctgaacgccgccaacgcccgctggggctcgctgtacgac
gcgctgtatggcacggacgccatcagcgaagaaggcggcgccgagaagggcaagggctac
aaccctgtgcgcggcgccaaggtcatcgcattcgcacgcaacttcctcgatcaggccgtg
cccctggcttccggctcgcacaaggattccaccggctacgctgtcgaaggcggcaagctg
gtcgtgtccctgaaggacggcagcaagaccggcctgaaggacgaagccaagttcatcggc
taccagggcgatgctgcggctcccaagtcggtgctgctcaagaataacggcatccacatc
gacatcatcatcaacaagtccacccccatcggcagcaccgatgctgccggcgtggccgat
gtggtggtcgaggccgccctgtccaccattctggatctggaagactccgtggccgccgtg
gatgccgaagacaaggtcaacggctacgccaactggctgggcattctcaagggcacgctg
accgaatcctttgaaaagggcggcaagaccgtgacccgtggcctgaaccccgaccgcgaa
tacaccggcgccgacggcaagcccgtgaagctgcacggccgctcgctgatgttcgtgcgc
aacgtgggccacctgatgaccaaccccgccgtgctgtggggccccgagcagaaggaaatc
cccgaaggcatcatggacgcgctggtgaccaccgccatcgccatccatgacctcaagggc
aacggtgccaacggcatcaggaacagccgcaccggcagcgtctacatcgtcaagcccaag
atgcacggccctgccgaagccgctttcgcgaacgaactgtttggccgcgtggaaaaggtt
ctgggcctgcccgagaacaccgtcaagctgggcatcatggacgaagagcgccgcacctcg
accaatctgaaggccgccattgcagccgccccggcacgcgttgccttcatcaacaccggc
ttcctggaccgcaccggcgatgaaatgcacaccgccatgtatgccggccccatggtccgc
aaggccgacatgaagacctgcgcctggctgcccgcctatgaaaagaacaatgtgctggtc
ggcctgaacatgggcctgcgcggccgcgcccagatcggcaagggcatgtgggccatgccc
gatctgatgaaggccatgctggagcagaagattgcccagcccaaggccggtgccaacacc
gcctgggtgccctcgcccaccggcgccaccctgcacgcactgcactatcaccagatcaat
gtggccgaagtgcaaaagggtctggaaagccccaacgccgacgccgagtgcgacgagctg
ctgaacgccatcctgcaagtgcccgtgtccaccaaccccaactggagcgatgtggaaaag
cagcaggaagtggacaacaacgtccaaggcatcctgggctatgtggtgcgctggatcgac
cagggcgttggctgctccaaggtgcccgacatccacaacgtgggcctgatggaagaccgc
gccacgctgcgcatctccagccagcacatcgccaactggctgcagcacggcatcgtcacc
gaagccatggtgcgcgacagctatgcccgcatggccaagatcgtggacgagcagaacgcc
ggcgacgccgcctacaagagcctggtggccaaccccgatggcgcggcttaccaagctgct
ctggatctggtgttcaagggcaaggaacagccttccggctacaccgaacccctgctgcac
gcctggcgcctgaaggtcaaggccggcgcctga

DBGET integrated database retrieval system