KEGG   Comamonas testosteroni CNB-2: CtCNB1_4684Help
Entry
CtCNB1_4684       CDS       T01109                                 

Definition
guanine-specific ribonuclease N1 and T1
Orthology
K01167  
ribonuclease T1 [EC:3.1.27.3]
Organism
ctt  Comamonas testosteroni CNB-2
Brite
Enzymes [BR:ctt01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.27  Endoribonucleases producing 3'-phosphomonoesters
    3.1.27.3  ribonuclease T1
     CtCNB1_4684
Transfer RNA biogenesis [BR:ctt03016]
 Eukaryotic Type
  3'processing and CCA adding factors
   3'processing factor
    CtCNB1_4684
 Prokaryotic Type
    CtCNB1_4684
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5235524..5235943
Genome map
AA seq 139 aa AA seqDB search
MLKAAAAKVYQTGLALMLGAAFALASPAALARKAPEVGATVPGFETVSLAELPREGRTTY
GRILQGGPFSSDKDGTVFGNRERILPRQARGYYREYTVRTPGAKNRGARRIVCGGLQPQV
PDACFYTGDHYNSFQQIVQ
NT seq 420 nt NT seq  +upstreamnt  +downstreamnt
atgctcaaggccgctgcagccaaggtatatcagacgggtttagcgttgatgctgggtgcc
gcttttgcgctggcatcccctgcggctttggcgcgcaaagcgccggaagtcggtgccacc
gttcccggctttgagaccgtgagcctggccgaactgccgcgcgaaggccgcaccacctat
ggccgcatactccagggcggcccgttctccagcgacaaggacggcacggtattcggaaac
cgtgagcgcatacttccgcgccaggccagaggctattaccgcgaatacaccgtgcgcacg
ccaggcgcgaaaaaccggggtgcgcgacgcatagtctgtggcggcttgcagccccaggtg
cccgatgcctgcttctacacgggcgaccactacaacagctttcagcaaatcgtccaatga

DBGET integrated database retrieval system