KEGG   Comamonas testosteroni CNB-2: CtCNB1_4775Help
Entry
CtCNB1_4775       CDS       T01109                                 

Definition
(RefSeq) succinyl-CoA synthetase, beta subunit
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
ctt  Comamonas testosteroni CNB-2
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ctt00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CtCNB1_4775
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CtCNB1_4775
   00640 Propanoate metabolism
    CtCNB1_4775
   00660 C5-Branched dibasic acid metabolism
    CtCNB1_4775
Enzymes [BR:ctt01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     CtCNB1_4775
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5339208..5340368)
Genome map
AA seq 386 aa AA seqDB search
MKIHEYQGKEILRQFGVPVPRGIPAFTVQEAVEAAQKLGGPVWVVKAQIHAGGRGKGGGV
KVAKSIEDVQKLSEQILGMQLVTHQTGPEGQKVRRLYIEDGADIKNELYVSLVTDRATQK
VALIASSEGGMDIEEVAHSTPEKIITEMIDPLTGITEAQSRKVAAAIGLEGKSVDQAVDL
FAKIYKCYMDTDASLVEINPLNCDSKGDLMALDAKFNFDPNALFRHPEIVAFRDLDEEDA
AEIEASKFDLAYISLDGNIGCLVNGAGLAMATMDTIKLFGGEPANFLDVGGGATAEKVTE
AFKIMLKNPEVKGILVNIFGGIMKCDTIATGVVTACKAVNLSVPLVVRMKGTNEELGKQI
LKDSGLPIIAADTMAEAATKIVAAVK
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgaagattcatgaataccaaggcaaggaaatcttgcgccaatttggtgtgcccgttccc
cgtggcattcctgcgtttaccgtgcaagaggctgttgaagcagcccagaagctgggtgga
cccgtgtgggtggtgaaggcccagatccacgctggcggccgcggcaagggcggcggcgtg
aaggttgccaagtccatcgaggacgtgcaaaagctgtccgagcagatcctgggcatgcag
ctggtgactcaccagaccggccccgaaggccagaaggtccgtcgcctgtacatcgaagac
ggcgccgacatcaagaacgagctgtatgtgtcgctggtgaccgaccgcgccacgcagaag
gttgccctgatcgcttccagcgaaggcggcatggacatcgaggaagtggctcactccact
cccgaaaagatcatcaccgagatgatcgaccccctgaccggcatcaccgaagcgcaatcg
cgcaaggtggcagctgccatcggtctggaaggcaagtccgtggatcaggccgtggatctg
ttcgccaagatctacaagtgctacatggacaccgacgcgtcgctggtggaaatcaacccc
ctgaactgcgactccaagggcgacctgatggccctggacgccaagttcaactttgacccc
aacgctctgttccgtcaccccgaaatcgtggctttccgcgatctggacgaagaagacgct
gccgaaatcgaagcctccaagttcgatctggcctacatctccctggacggcaacatcggc
tgtctggtgaacggcgccggtctggccatggccaccatggacaccatcaagctgttcggc
ggcgaaccagccaacttcctggacgtgggcggcggcgctacggccgagaaggtgaccgaa
gccttcaagatcatgctcaagaaccccgaagtcaagggcattctggtcaatatcttcggc
ggcatcatgaagtgcgacaccatcgccaccggcgtggtcactgcctgcaaggccgtgaac
ctgtccgtgcctctggtcgtgcgcatgaagggcaccaacgaagaactgggcaagcaaatc
ctcaaggattccggcctgcccatcatcgctgccgacaccatggctgaagcagcgaccaag
atcgttgctgccgttaagtaa

DBGET integrated database retrieval system