KEGG   Chlamydia trachomatis RC-J/971: CTRC971_00295Help
Entry
CTRC971_00295     CDS       T02769                                 

Gene name
sucA
Definition
2-oxoglutarate dehydrogenase E1 component (EC:1.2.4.2)
Orthology
K00164  
2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
cttj  Chlamydia trachomatis RC-J/971
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cttj00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CTRC971_00295 (sucA)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CTRC971_00295 (sucA)
  Amino acid metabolism
   00310 Lysine degradation
    CTRC971_00295 (sucA)
   00380 Tryptophan metabolism
    CTRC971_00295 (sucA)
Enzymes [BR:cttj01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     CTRC971_00295 (sucA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
60989..63700
Genome map
AA seq 903 aa AA seqDB search
MDSDFARHVHSSDIDWIESLFERFEKHEPMDSSWKYFFEGYQVGKTEGSPTESSHDQFFT
SLQEKKAHSLLMIYRYYGYLQGQVSPISSSEESSLVTEKVRNFDPQEEIPSLGLLPQSYV
RIADFIQVLKEKYCRSISVETLNCSPEIQEYVWKLMEGEKPSLTKEVLLARYRDVKRAVA
FEEFLQVKFTGKKRFSLEGGESLVPMLEHLIACGVKQGINRYVMGMPHRGRLNVLANIFG
KPYRQIFMEFEDAPQIRGLETVGDVKYHKGYVANRPEQNVMMALLPNPSHLESVDPVVEG
AVAAIQHQGEAGKEQACLAVLMHGDAALAGQGVVYETFQLSGIPGYSTEGTVHIVVNNQI
GFTAQPRESRSTPYCTDIAKMMGIPVFRVNGEDVLACLQVMEYAIHIRERFHCDVIIDLC
CYRKYGHNESDDPSVTAPFLYEEIKKKKQGSELFKEILLHHPEWNISSNELERIDTEIAH
VLNQEYASLKDPGVERLDECMHCTRMAAGELLVDNVDTSLDKEALFDLSAKLCDIPEHFS
PHAKIRSLLNKRMSMADGEIGYDWGMAEEVAFASLLQEGFSLRLSGQDSIRGTFSQRQLV
WTDVQTGDTFSPLYHLSPSQGSVELYNSPLSEYAVLGFEYGYAQQAEKTLVIWEAQFGDF
SNGAQIIFDQYISSGIQKWDLHSDVVVLLPHGYEGQGPEHSSARIERYLQLASDWNFQVV
LPSTPVQYFRILREHTKRDLSLPLIIFSPKMLLRHPQCVSSIAEFGMKGGFKPFLEDENP
NYHAKVLVLCSGKIYYDYRASLPKDLECRFACIRVESLYPLYLEDLLVLISKYTEVHHYV
WLQEEPQNMGAFSYFALATDEIFPSKLQCVCRPRSSSTATGSASLSQKELSMLMETLFSI
GRE
NT seq 2712 nt NT seq  +upstreamnt  +downstreamnt
atggattcagactttgctaggcatgtgcattcatcagatattgactggatagaatctttg
ttcgagcgatttgagaagcatgagccgatggattcttcatggaaatatttctttgaaggt
tatcaagttgggaagacggaggggagcccaacagaatcttctcatgatcaattctttacg
tctttgcaagagaaaaaagcacacagtcttttgatgatataccgttattacggctattta
caggggcaagtgtctccaatatcctcatcagaagaatcttctctagttacagaaaaggtt
cgtaatttcgatcctcaagaagagattccttctttaggattattaccgcaatcttatgtt
cgtatagcagactttattcaggtattaaaagagaagtattgtcggagcatctctgttgag
acattgaattgctctcctgagatccaagaatatgtctggaaactcatggaaggagagaag
ccctctttaactaaagaagttcttctggcgcgatatcgagacgtaaaaagagcagtagct
tttgaagaatttttacaggttaaattcacaggaaaaaagcgcttttctctagaaggtgga
gagagcttggttcccatgttggagcatctcattgcttgtggggttaagcaaggcatcaat
cgttacgtgatgggaatgcctcatcgaggccgattaaacgttcttgctaacatttttgga
aagccttaccggcagattttcatggagtttgaagacgctccccaaataagagggctggaa
actgttggtgatgtaaagtaccacaagggatatgttgccaataggccggaacagaacgtt
atgatggctttattgccgaatccgagccatttagagtccgtggatcctgttgtggaaggt
gctgtagcagcgattcaacatcagggagaggctgggaaggagcaagcctgcttagctgtg
ttgatgcatggagatgcagccttggcgggtcagggcgttgtatatgaaactttccagttg
agtgggataccaggttattcaacagaaggaactgtgcatattgtagtgaataatcagata
ggtttcactgcgcagcctcgagagtctcgttctactccttattgtacagatatagctaaa
atgatggggatccctgtattccgagtgaatggagaggatgttttagcctgtctccaggtc
atggagtatgctatacatatccgtgagcgttttcattgtgatgtgattatcgacctctgt
tgttatcgaaaatacggtcacaatgaaagtgacgatccttctgttacagctccattttta
tacgaagagatcaaaaagaaaaaacaagggtcagaattattcaaagagatccttttacac
catcctgaatggaacatttcttccaacgagttggagagaatagacacagagatagcgcat
gttttaaaccaggagtacgcttctctgaaagatccaggtgtcgaacggctagatgaatgt
atgcattgcactcgtatggcagctggagagcttcttgtcgataatgtggatacatcgtta
gacaaagaagccttgtttgatctgagtgccaaactttgtgatattcctgagcatttttct
cctcatgcaaagattcgatctttattaaataagcgtatgagcatggctgatggagagatc
ggttatgattggggaatggctgaagaggtggcgttcgcttccttattacaagaaggtttt
tcattacgtttgtcaggacaagattctattcgtggaactttcagtcaacgacagttagtc
tggacggatgtccagacaggggatacattctctccattatatcacttgtctccgagtcaa
ggcagcgtggaattatacaattcccctctatctgaatacgctgttttaggctttgaatat
ggttatgcacaacaagcagaaaagactcttgttatttgggaagcgcagtttggagacttt
tccaatggagcccaaatcatttttgaccaatatatttcttccggaattcagaaatgggat
ttacattccgatgtagttgtactgcttcctcatggctatgaggggcaaggacctgagcat
tcctcggctcgtatagagcgttatttacagctcgcttccgattggaattttcaagttgtt
cttccttctactcccgtacagtattttcgtattctgcgggagcatacgaagagagacctc
tctcttcctcttatcattttttctcctaagatgttattgcggcatccgcagtgcgtgagt
tctatcgcagagtttggaatgaagggaggcttcaagcctttcttggaagacgagaatcct
aactatcatgcaaaagttcttgttctttgtagtggcaagatttattacgactatcgtgct
tctcttcctaaagatcttgaatgtcgttttgcttgtatacgagtagagagtttgtatcca
ttatacttagaagatctattggttctgataagcaaatatacggaagttcaccattatgta
tggttgcaagaagaacctcaaaatatgggcgcttttagttattttgcattagcaactgac
gagattttccctagcaaattgcagtgcgtttgccgtcctaggagtagttcaacggcaaca
ggatctgcgagtttaagtcaaaaagaattatcgatgttaatggaaaccctgttttctata
ggtagagagtag

DBGET integrated database retrieval system