KEGG   Siccibacter turicensis: CTU_01220Help
Entry
CTU_01220         CDS       T00999                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ctu  Siccibacter turicensis
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ctu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CTU_01220 (tpiA)
   01230 Biosynthesis of amino acids
    CTU_01220 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CTU_01220 (tpiA)
   00051 Fructose and mannose metabolism
    CTU_01220 (tpiA)
   00562 Inositol phosphate metabolism
    CTU_01220 (tpiA)
Enzymes [BR:ctu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     CTU_01220 (tpiA)
Exosome [BR:ctu04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   CTU_01220 (tpiA)
  Exosomal proteins of bladder cancer cells
   CTU_01220 (tpiA)
  Exosomal proteins of melanoma cells
   CTU_01220 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(127273..128076)
Genome map
AA seq 267 aa AA seqDB search
MFLNSLSAWRMKMRHPLVMGNWKLNGSRHMVNELVANLRKELAGVSGCDVAIAPPAMYLD
LAKQAAAGSHIILGAQNVDVNLSGAFTGETSAEMLKDIGAKYIIIGHSERRTYHAESDEL
IAKKFAVLKAQGLVPVLCIGETEAENEAGKTEEVCARQLDAVLKTQGAAAFEGVVIAYEP
VWAIGTGKSATPAQAQAVHKFIRDHIAKADAKVAEQVIIQYGGSVNAANAAELFTQPDID
GALVGGASLKADAFAVIVKAAEEAKKA
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atattccttaattcgcttagcgcgtggagaatgaaaatgcgacatcctttagtgatgggt
aactggaaactgaacggcagccgccacatggtaaacgagctggtagctaacctgcgtaaa
gagctggctggcgtatctggctgtgacgtagcgatcgccccgccggcgatgtatctggat
ctggcgaagcaagccgccgctggcagccacatcattcttggcgctcagaacgtcgacgtt
aacctctccggcgcgttcaccggtgaaacttccgctgaaatgcttaaagatatcggcgcg
aaatacatcattatcggccactccgagcgtcgtacttatcacgcggaatctgacgagctg
atcgcgaagaaattcgccgtgctgaaagcgcagggtctggttccggtactgtgcatcggt
gaaaccgaagccgaaaacgaagcgggcaaaacggaagaagtgtgcgcacgtcagcttgac
gccgtgctgaaaacccagggcgccgccgcgttcgaaggcgttgtgattgcttacgaaccc
gtatgggctatcggtaccggcaaatccgctaccccggcccaggcgcaggcggttcacaag
ttcatccgtgaccacatcgccaaagctgacgcgaaagtcgccgagcaggttatcattcag
tacggcggttctgtaaacgcggctaacgcggcagaactcttcacccagccggacatcgac
ggcgcgctggttggcggcgcctctctgaaggcggacgcgttcgcggttatcgtgaaagcc
gctgaagaagcgaaaaaagcgtaa

DBGET integrated database retrieval system