KEGG   Cronobacter turicensis: CTU_01500Help
Entry
CTU_01500         CDS       T00999                                 

Gene name
rafA
Definition
(GenBank) Alpha-galactosidase
  KO
K07407  alpha-galactosidase [EC:3.2.1.22]
Organism
ctu  Cronobacter turicensis
Pathway
ctu00052  Galactose metabolism
ctu00561  Glycerolipid metabolism
ctu00600  Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:ctu00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    CTU_01500 (rafA)
  Lipid metabolism
   00561 Glycerolipid metabolism
    CTU_01500 (rafA)
   00600 Sphingolipid metabolism
    CTU_01500 (rafA)
Enzymes [BR:ctu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     CTU_01500 (rafA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Melibiase Glyco_hydro_36N Glyco_hydro_36C Melibiase_2
Motif
Other DBs
NCBI-ProteinID: CBA26890
UniProt: C9Y4L5
Position
153094..155277
Genome map
AA seq 727 aa AA seqDB search
MASETFRINSKSILFTGDAFMETRLYRLTSPTTDVVIKTQPFAEILYWGPHLAHFSPQDC
ASLIRPVANGRLDGDSPVTLMAENGHGLFGAPGLEGHRNGFDASPVFATREVSQNGQTLV
ITSEDATAGLRLVSELALSDSGVLKVRHGLTNLRDGAWQVDRFAVTLPVAERAFEVMAFH
GRWTREFQPHRVTLSHDGFVLENRRGRTSHEHFPALIAGTPGFGEQHGDVWGVHLGWSGN
HRLKCEAKTDGRRYLQAEALYLPGEMALATGETLHTPWLYASHSSRGLNGMSQQFHRFLR
DEIIRFPGNKPRPVHLNTWEGIYFDHQPEYIMRMATEAAALGVERFIIDDGWFKGRNDDH
AALGDWYLDEQKYPDGLMPVIHHVKNLGMEFGIWVEPEMINPDSDLYRAHPDWVLALPGY
PKTTGRHQWVLNLNMPDAFDYLLERMSWLLGEHPVDYVKWDMNRELVQPGHAGKAAADAQ
TRQFYRLLDVLRARFPNVEFESCASGGGRIDFEVLTRTHRFWASDNNDALERNTIQRGMS
YFFPPEVMGAHIGNPRCHATFRQHSIEFRGLTALFGHMGLELDPVSAGAQEAAGYQRYAA
LYKEWRELIHTGDLWRVEMPDAATQVQGVVSQDKTQGLFLVSQLAMPDYTLPGALRVPGL
DPQARYQVRLVDHPNIQLTGAGGHTMRQLPGWMNEPVSASGEWLTQAGLQLPVLDPETAI
LIAFERV
NT seq 2184 nt NT seq  +upstreamnt  +downstreamnt
ttggcatccgaaacgtttcggatcaacagtaaaagcattctttttaccggagatgctttt
atggaaacccgcctttatcgtctgaccagccccacaaccgatgttgttatcaaaacccag
ccattcgccgaaattctctactgggggccgcatcttgcccatttttcgccgcaggattgc
gcgagccttatccgcccggtcgctaacggccgactggacggcgattcgcccgtcacgctg
atggcggagaacggtcacgggcttttcggcgcaccggggctggaagggcaccgtaacggg
tttgatgcctcgccggtgttcgccacgcgggaagtgagccagaacgggcaaacgctggtg
atcaccagtgaagacgccaccgccgggttgcggcttgtgagcgaactggcgctcagcgac
agcggcgtgctgaaagtgcgtcacgggcttaccaacctgcgcgacggggcctggcaggtg
gatcgtttcgcggtcacgctgccggtggcggagcgggcgtttgaagtgatggcgtttcat
ggtcgctggacgcgcgagttccagccgcaccgcgtgacgttaagccatgatggctttgtg
ctggagaaccgccgcgggcgcacctcgcacgagcattttccggcgcttatcgccggtacg
ccggggtttggcgagcagcacggcgacgtctggggcgtgcatctcggctggagcggcaac
caccggctgaagtgcgaagcgaaaaccgacgggcggcgctatctccaggccgaggcgctc
tatctgccgggcgaaatggcgctggcgaccggcgagacgctgcacacgccctggctctac
gcgagccattcctcgcgcggcctcaatggcatgagccagcagttccaccgctttctgcgc
gatgaaatcatccgtttccccggcaataaaccgcgcccggtgcatctcaacacctgggag
gggatctacttcgaccaccagccggaatacatcatgcggatggcgaccgaggctgcggcg
ctcggcgtggagcgctttatcatcgacgacggctggtttaagggccgcaacgacgatcac
gcggcgctcggcgactggtatctcgatgaacagaaatacccggacggcctgatgccggtg
atccaccacgtaaaaaacctcggcatggaattcggcatctgggtggagccggagatgatc
aaccccgattccgatctttaccgcgcgcacccggactgggtactggcgctgccgggctac
ccgaagaccaccgggcgacatcagtgggtgctcaacctgaacatgcctgacgcattcgat
tatctgctggaacgcatgagctggcttttgggcgagcatcctgtcgattacgtgaagtgg
gacatgaaccgcgagctggtgcagccgggccacgcaggcaaagcggcggcggacgcccag
acgcgccagttctatcgtctgctggatgtgctgcgcgcgcgcttcccgaacgtcgagttt
gaatcctgcgcgtccggcggcgggcgtatcgatttcgaggtgctgacgcgcacgcaccgc
ttctgggcctccgacaacaacgacgcgctggagcgcaatactatccagcgcggcatgagc
tacttcttcccgccggaagtgatgggcgcgcatatcggcaacccgcgctgccacgccacg
ttccgccagcacagcattgaatttcgcggcctgacggcgctgttcggtcacatggggctg
gagctggacccggtcagcgccggggcgcaggaggccgcgggatatcagcgctatgccgcg
ctctataaggaatggcgcgagcttatccataccggcgacctgtggcgcgtggagatgccg
gacgccgccacgcaggtgcagggcgtcgtcagccaggacaagacacaggggctgtttctg
gtaagccagctggcgatgccagactacacgctgccgggcgcgctgcgcgtgccggggctg
gatccgcaggcccgttaccaggtgcgtctcgtggatcatccgaatattcagctgaccggc
gcgggcggccacaccatgcgccagttgcccggctggatgaacgagcctgtcagcgccagc
ggcgaatggctgacgcaggcggggctgcaactgccggtgcttgatccggaaaccgcgata
cttatcgcgtttgagcgcgtgtaa

DBGET integrated database retrieval system