KEGG   Cronobacter turicensis: CTU_02360Help
Entry
CTU_02360         CDS       T00999                                 

Gene name
hemD
Definition
(GenBank) Uroporphyrinogen-III synthase
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
ctu  Cronobacter turicensis
Pathway
ctu00860  Porphyrin and chlorophyll metabolism
ctu01100  Metabolic pathways
ctu01110  Biosynthesis of secondary metabolites
ctu01120  Microbial metabolism in diverse environments
Module
ctu_M00121  Heme biosynthesis, glutamate => heme
ctu_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:ctu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CTU_02360 (hemD)
Enzymes [BR:ctu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     CTU_02360 (hemD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4
Motif
Other DBs
NCBI-ProteinID: CBA27055
UniProt: C9Y4V1
Position
complement(265876..266616)
Genome map
AA seq 246 aa AA seqDB search
MTILVTRPSPAGEELVSRLRALGQEAWSFPLIEFCPGRELAQLPALLDALAPDDLLFALS
QHAVSFANAHLQRLGRRFPRTVEAFAIGRTTALALHQVSGLHVHYPRDREISEVLLQLPE
LQNVAGKRALILRGNGGRELLGETLTERGAAVTFCECYQRSAKIYDGPQEAHRWHTRGIT
TLVVTSGEMLRQLHDLVPPWYRANWLLRCRLVVVSERLATLARELGWQNILVADNADNDA
LLRALQ
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgacgattctggtcacccgcccctctcccgccggggaggaattagtgagccgcctgcgc
gcactggggcaggaggcctggagttttccgctgatcgaattctgccctggccgggagctg
gcgcaactgcctgcgctgcttgatgcgctcgcgccagacgatctgctttttgcgctctcg
caacacgcagtgagttttgcgaacgcgcatttgcagcgtctggggcgtcgctttccgcga
accgtcgaggcattcgccatcggtcgcaccaccgcgctggcgctgcatcaggtcagcggt
ttgcacgtccattacccgcgcgatcgggaaatcagtgaagtcttgctacaattacctgaa
ttacaaaacgttgccggtaagcgcgcgctcatcctgcgcggcaacggcggtcgcgaacta
ttaggggaaaccttaacggaacgcggcgcggcagtgacgttttgcgagtgctatcaacgt
agcgcgaaaatttacgacggcccgcaggaagcgcaccgctggcatacgcgcggcattacc
acgctggtagtgaccagcggcgaaatgctgcgccagctgcatgatctcgtgccgccatgg
tatcgcgcgaactggttgctgcgctgtcggctggtggtcgtcagcgaacgtctggcgacg
cttgcccgggaactgggctggcagaacattctggtcgctgataacgccgataacgacgcg
ctgctgcgcgcgttgcaataa

DBGET integrated database retrieval system