KEGG   Cronobacter turicensis: CTU_02560Help
Entry
CTU_02560         CDS       T00999                                 

Gene name
pldB
Definition
lysophospholipase L2 (EC:3.1.1.5)
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
ctu  Cronobacter turicensis
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:ctu00564]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
284853..285845
Genome map
AA seq 330 aa AA seqDB search
MTRHRNSWFSREAGFAAFTMGALTDFWQQREEDEFLGVDNIPVRFVRFRAEKHDRVIVVC
PGRIETYVKYAELAYDLFHCGFDVLIIDHRGQGRSGRLLEDTHRGHVVNFSDYVDDFERF
WQQEVATGPWRKRYLLAHSMGGAIGTLFQLRNPNAFDAVALCAPMFGIIIRLPDWMLRSI
LDWAEEYPSLRDGYAIGTGRWRPLPFSLNMLTHSHERYRRNLRFYADEPQLRVGGPTYHW
VREGIQAGEQVLAGATDSTTPLLLLQAELERVVDNRSHDRFCELRAAAGHPCWGGKPYVI
KGAYHEILFEQDAMRAEALNAIVDFFDEHN
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgaccagacacaggaacagttggttttcacgggaagccgggttcgcggcgttcacgatg
ggcgcgctgacggatttctggcagcagcgcgaagaagatgagtttttgggtgttgataac
attccggtgcgctttgtgcgttttcgtgctgaaaagcacgatcgcgttatcgtcgtctgc
cctggtcgcatcgaaacctacgtaaagtatgcggaactggcatacgatctgtttcactgt
gggtttgacgtgctgattatcgaccaccgcgggcaggggcgttccggccggctgctggaa
gatacgcatcgcggccatgtcgtgaatttcagcgactatgtcgatgatttcgaacgtttc
tggcagcaagaagtagcgactggcccatggcgtaaacgctatctgctggcgcattcgatg
ggcggggctattgggacgctgtttcagttgcgtaacccgaacgcgtttgatgctgtggcg
ctctgcgcgccgatgttcggcatcattatccgcctgccggactggatgctgcgctcgatc
ctcgactgggcggaagagtacccgtcgctgcgcgatggttacgccatcggcaccggacgc
tggcggccactgccctttagcctcaacatgctgacgcacagccacgagcgctaccggcgc
aatctgcgtttttatgccgacgaaccgcaactgcgcgtcggcggacctacgtatcactgg
gtgcgggaaggcatccaggcaggagaacaggtgctggcgggggccaccgacagcaccacg
ccgctattgttactccaggcagagctggaacgtgtggtggataaccgctcgcacgaccgc
ttctgtgaacttcgcgccgcggcgggccacccgtgttgggggggtaaaccttacgtcatc
aaaggggcgtaccatgagatcctgtttgagcaggacgctatgcgcgccgaagcgctgaat
gccattgtcgatttcttcgacgagcataactga

DBGET integrated database retrieval system