KEGG   Cronobacter turicensis: CTU_02770Help
Entry
CTU_02770         CDS       T00999                                 

Gene name
fadB
Definition
(GenBank) Fatty acid oxidation complex subunit alpha
  KO
K01825  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
ctu  Cronobacter turicensis
Pathway
ctu00071  Fatty acid degradation
ctu00280  Valine, leucine and isoleucine degradation
ctu00281  Geraniol degradation
ctu00310  Lysine degradation
ctu00362  Benzoate degradation
ctu00380  Tryptophan metabolism
ctu00410  beta-Alanine metabolism
ctu00640  Propanoate metabolism
ctu00650  Butanoate metabolism
ctu00903  Limonene and pinene degradation
ctu00930  Caprolactam degradation
ctu01040  Biosynthesis of unsaturated fatty acids
ctu01100  Metabolic pathways
ctu01110  Biosynthesis of secondary metabolites
ctu01120  Microbial metabolism in diverse environments
ctu01130  Biosynthesis of antibiotics
ctu01200  Carbon metabolism
ctu01212  Fatty acid metabolism
Module
ctu_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:ctu00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    CTU_02770 (fadB)
   00650 Butanoate metabolism
    CTU_02770 (fadB)
  Lipid metabolism
   00071 Fatty acid degradation
    CTU_02770 (fadB)
   01040 Biosynthesis of unsaturated fatty acids
    CTU_02770 (fadB)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CTU_02770 (fadB)
   00310 Lysine degradation
    CTU_02770 (fadB)
   00380 Tryptophan metabolism
    CTU_02770 (fadB)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CTU_02770 (fadB)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    CTU_02770 (fadB)
   00281 Geraniol degradation
    CTU_02770 (fadB)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CTU_02770 (fadB)
   00930 Caprolactam degradation
    CTU_02770 (fadB)
Enzymes [BR:ctu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     CTU_02770 (fadB)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     CTU_02770 (fadB)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     CTU_02770 (fadB)
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  Delta3-Delta2-enoyl-CoA isomerase
     CTU_02770 (fadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2
Motif
Other DBs
NCBI-ProteinID: CBA27137
UniProt: C9XTB2
Position
complement(305502..307691)
Genome map
AA seq 729 aa AA seqDB search
MLYKGDTLYLNWLEDGIAELVFDAPGSVNKLDTATVASLGHALDVLEKQHDLKALLLRSE
KAAFIVGADITEFLSLFQVPAEQLSQWLHFANSVFNRLEDLPVPTLCAINGYALGGGCEC
VLATDFRLATPDARIGLPETKLGIMPGFGGSVRLPRLLGADSALEIIAAGKDITADAALK
VGLVDAVVKPEKLTEGALRMLRQAIDGELDWKARRQPKLEPLHLSKIEAAMSFTIAKGMV
MQTAGKHYPAPMTAVKTIEAAAGLGRDEALALENKSFVPLARSSEARALVGIFLNDQYVK
GLAKKLTKETEMPKQAAVLGAGIMGGGIAYQSAWKGVPVIMKDINEKSLALGINEASKLL
NKQLERGKIDGLKLAGVIATIHPTLDYAGFERADVVVEAVVENPKVKKAVLAETEDKVRP
DTVIASNTSTIPISELASVLKRPENFCGMHFFNPVHRMPLVEVIRGEKTSDATIAKVVAW
ASKMGKTPVVVNDCPGFFVNRVLFPYFAGFSQLLRDGADFRQIDKVMEKQFGWPMGPAYL
LDVVGIDTAHHAQAVMAAGFPQRMQKDYRDAIDALFEAGRFGQKNGKGFYAYQEDSKGKP
RKVPDDAVDSLLAEVSQPKRAFSDEEIVARMMIPMVNEVVRCLEEGIIASPAEADMALVY
GLGFPPFHGGAFRWLDTQGSAAYLDMAQRYQHLGPLYEAPAGLREKASHNAPYYPQVEPA
QPVGELQTA
NT seq 2190 nt NT seq  +upstreamnt  +downstreamnt
atgctctacaaaggcgacaccctgtaccttaactggctggaagacggcattgccgaactg
gtgttcgatgcccccggctcggtgaacaagcttgataccgcgaccgtagcaagcctgggc
catgcgctggatgtgctggaaaaacaacacgatctcaaagccctgctgctgcgctcggaa
aaagccgcgtttatcgtcggcgccgacattaccgaattcctctcgctgttccaggtgccc
gctgagcagttaagccagtggttgcactttgccaacagcgtgtttaaccgtcttgaagat
ctgccggtgccgacgctgtgcgccattaatggctacgcgttaggcggcggctgcgagtgc
gtgctggcgaccgatttccgtctcgccacgccggatgcccgcatcggcctgccggaaacc
aaacttggcatcatgccgggctttggcggctcggtacgcctgcctcgcctgctgggcgcc
gacagcgcgctggaaatcatcgcggccggtaaagacatcaccgccgacgcggcgctgaaa
gtgggcctggtcgacgcggtcgttaaaccggaaaaactgactgaaggggcgctgcgtatg
ctgcgccaggccatcgacggcgaactcgactggaaagcgcgccgccagccgaaacttgaa
ccgctgcacttaagtaaaatcgaagccgccatgagctttaccatcgccaaaggcatggtg
atgcaaaccgccggcaaacactacccggcgccgatgacggcggtgaaaaccattgaagcc
gccgcagggctgggccgtgacgaggcgctggcgctggagaacaaaagctttgttccgctg
gcgcgatccagcgaagcgcgcgcgctggtcggtatcttcttaaatgaccagtacgtcaaa
ggcctcgcgaaaaagctgaccaaagagaccgaaatgccgaagcaggcggcggtgctgggc
gcgggcattatgggcggcggcatcgcttaccagtcagcctggaaaggcgtgccggtcatc
atgaaagacatcaacgagaaatcgctggcgctcggcatcaacgaagccagtaaactactg
aataaacagctggagcgcggcaaaatcgacgggctgaagctcgcaggggtcatcgccacc
atccatccaacgctggattacgccgggtttgagcgcgccgatgtggtcgtcgaagccgtc
gtggaaaacccgaaagtgaaaaaagcggtgctggcggaaaccgaagacaaggtgcgcccg
gataccgtgattgcctccaatacctccaccattcctatcagcgaactggcgagcgtgctg
aaacgtccggaaaacttctgcggtatgcacttctttaacccggtgcaccgtatgccgctg
gttgaagtgatccgcggcgagaaaacctccgacgccacgatcgcgaaagtggtggcctgg
gccagcaaaatgggcaaaacgcctgtcgtggtgaacgactgccctggcttcttcgttaac
cgcgtactgttcccctacttcgccggtttcagtcagctgctgcgcgacggcgccgatttc
cgccagatcgataaagtcatggagaaacagttcggctggccgatgggcccggcgtatctg
ctggatgtggtgggcatcgataccgcgcaccatgcgcaggccgtcatggcggcaggcttc
ccgcaacgcatgcaaaaagattaccgcgatgcgatcgacgcgctgtttgaggctggccgc
ttcggacagaaaaacggcaaaggcttctatgcctatcaggaagacagcaaaggtaaaccg
cgcaaagtgccggatgacgcagtggacagcttgttggcggaagtaagtcagccaaagcgc
gcgttcagcgatgaagagatcgtggcgcgcatgatgatcccgatggtcaacgaagtggtg
cgctgtctggaagaaggcattatcgcaagccccgccgaggcggatatggcgctggtctac
ggcctcggcttcccgccgttccacggcggcgcgttccgctggctggatacccagggcagc
gcggcttatctcgatatggcgcagcgctatcagcatctcggcccgctctatgaagcgcct
gccgggcttcgcgaaaaagcgagccacaatgcgccttattatccccaggttgaacccgcc
caaccggtgggcgaactgcaaacggcttaa

DBGET integrated database retrieval system