KEGG   Cronobacter turicensis: CTU_04460Help
Entry
CTU_04460         CDS       T00999                                 

Gene name
scrB
Definition
(GenBank) Sucrose-6-phosphate hydrolase
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
ctu  Cronobacter turicensis
Pathway
ctu00052  Galactose metabolism
ctu00500  Starch and sucrose metabolism
ctu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ctu00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    CTU_04460 (scrB)
   00500 Starch and sucrose metabolism
    CTU_04460 (scrB)
Enzymes [BR:ctu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     CTU_04460 (scrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C Glyco_hydro_43
Motif
Other DBs
NCBI-ProteinID: CBA27475
UniProt: C9XU63
Position
complement(489265..490674)
Genome map
AA seq 469 aa AA seqDB search
MTIRTLLPAILQAVMKGLPVALGDRHYPRWHLAPVTGLMNDPNGFIHFQGRYHLFYQWNA
LGCQHQHKCWGHWSSADLTHWRHEPLALMPDEEYDRSGCYSGSAVDDNGRLTLCYTGNVK
FDDGTRTAWQCLAVQNADGGFDKLGPVMPLPGGYTGHVRDPKVWRHGDRWYMVLGAQDLA
LQGKVLLLRSDNLWNWENLGEIAGSTLGGLGEAGYMWECPDLFMLDGKAILICCPQGVTR
EEKRYLNTYPSAYLCGDLDYDKPEFRHGPLVELDAGFEFYAPQTTLADDGRRLLIGWMGV
PDGEEMLQPTVAQGWIHQMTCPRELTLRDGKLCQQPARELAALRGEEQRLEGVAATLPSL
AAESLELVLEAQGEVTLDFADTLRLEWTRDGLRLARRSLACSEWMHRYWQGDARRLHILC
DRSSVEIFINDGEGVMSSRYFPAAGAKLGFEGDAQLRLRYWSLRACMVE
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgaccatccgcacgctgctgcctgccattttacaggccgtgatgaaaggcctgccggtc
gcgcttggcgatcgccactacccgcgctggcatctggcgccggtcacgggcctgatgaac
gatccgaacggttttatccattttcaggggcgttaccacctgttttatcagtggaacgcg
ctgggttgccagcaccagcataagtgctggggacactggagctcggcggatctgacgcac
tggcgacacgagccgctggcgctgatgccggatgaagagtatgaccgcagcggctgttat
tcaggcagcgcggtggatgacaacgggcgtctgacgctctgctataccggcaacgtgaaa
tttgacgacggcacccgcaccgcctggcagtgtctggcggtgcagaacgccgacggcggt
ttcgacaaactcggcccggtgatgccgctgcccggcggctataccggccacgtgcgcgac
ccgaaagtctggcgtcacggcgatcgctggtacatggtgctgggcgcgcaggatctggca
ttgcagggcaaagtcctgctgctgcgctccgacaacctgtggaactgggaaaacctgggc
gagatcgctggcagcacgctcggcgggctcggcgaggcgggttatatgtgggagtgcccg
gatctcttcatgctggacggcaaagcgattctgatctgctgcccgcagggcgttacgcgc
gaagaaaaacgctatctcaacacctacccgagcgcgtacctgtgcggcgatctggactac
gacaagccggagtttcgtcacggcccgctggtagagctggacgccggttttgaattttac
gcgccgcaaaccacactggccgacgatggccgccggttactcatcggctggatgggcgtg
ccggacggcgaagagatgttgcagccgacggtggcgcagggctggatccaccagatgacc
tgcccgcgcgaactgacgctgcgcgacggcaaactctgccagcagccggcgcgcgaactc
gctgccctgcgcggcgaggagcagcgcctggagggcgtggccgccacgctcccctcgctc
gcggcggaaagcctggagctggtgctggaggctcagggcgaggtgacgctcgatttcgcc
gataccctgcgcctggaatggacgcgcgacggtctgcgtctggcgcgccggagcctggcc
tgcagcgagtggatgcatcgttactggcagggcgacgcccgccgcctgcacattttgtgc
gaccgctccagcgtcgagattttcattaacgacggcgaaggcgtgatgagcagccgctat
ttcccggcggccggcgcgaagcttggctttgagggcgacgcgcaactccggctacgctac
tggtcgttacgcgcctgcatggtagaatga

DBGET integrated database retrieval system