KEGG   Cronobacter turicensis: CTU_05120Help
Entry
CTU_05120         CDS       T00999                                 

Gene name
15
Definition
Lysozyme (EC:3.2.1.17)
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
ctu  Cronobacter turicensis
Brite
Enzymes [BR:ctu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     CTU_05120 (15)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
553861..554367
Genome map
AA seq 168 aa AA seqDB search
MRNTPIRFSLNRQTGVTTMANIPTNTGIPGVELIKSFEGLRLDKYQDAVGKWTIGYGHLI
LPNENFTRALTLQEAEDLLRADLGMTERGIRQMVKVDLNQNQFDALVSFAFNVGLGNLQS
STLLRLLNQGSYREAADQLLRWNKAGGNVLAGLTRRREAERLLFLTAL
NT seq 507 nt NT seq  +upstreamnt  +downstreamnt
ttgaggaatacaccaatcaggttctccctaaaccgacagacaggagtaacgacaatggct
aatatccccaccaataccggcatacccggcgtggaattaattaaatcctttgaagggctg
cgtctggataaataccaggacgccgtcggcaaatggaccatcggctacggccatcttatt
ttgccgaatgaaaattttacccgcgccttaacgcttcaggaggcggaagatctcctgcgc
gccgatttaggcatgaccgagcgcggtattcgccagatggtgaaagtggatctcaaccag
aaccagtttgacgcgctggtgagcttcgcctttaacgtcggccttggcaatctgcaaagc
agcacgctgttgcgattactgaatcagggcagttatcgcgaggcggcggatcagctttta
cgctggaataaagcgggcggtaacgtgctcgccggattaacccgtcgccgcgaagccgag
cgccttttatttctgaccgccctctga

DBGET integrated database retrieval system