KEGG   Cronobacter turicensis: CTU_05490Help
Entry
CTU_05490         CDS       T00999                                 

Gene name
ganA
Definition
beta-galactosidase galO (EC:3.2.1.23)
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
ctu  Cronobacter turicensis
Pathway
Galactose metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:ctu00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
591217..593277
Genome map
AA seq 686 aa AA seqDB search
MNKFAPLSPKVSALLHGADYNPEQWENYPGTVESDIAMMQQAKCNVMSVGIFSWAKLEPE
EGVFRFEWLDEIIDKLYQGGIHVFLATPSGARPAWMSQKYPQVLRVGRDRVPALHGGRHN
HCMSSPVYRDKTATINRLLAERYAHHPAVLGWHISNEYGGECHCDLCQANFRGWLKARYG
TLDKLNEAWWSTFWSHTFTDWSQIESPAPQGENTIHGLNLDWRRFNTAQVTDFCRHELAP
LKAVNPELPATTNFMEYFYDYDYWQLAEPLDFISWDSYPMWHRDKDETELACYTAMYHDL
MRTLKHGKPFVLMESTPGTTNWQPTSKLKKPGMHILSSLQAVAHGADSVQYFQWRKSRGS
VEKFHGAVVDHVGHIDTRIGREVAQLGDILSQLDPVAGARVDAQVAVIFDWESRWAMDDA
QGPRNLGLEYEKTVAEHYRPFWEQGIAVDIINADADLSAYKLVIAPMLYMVRDGFAPRVE
AFVEQGGHFVTTYWSGIVNETDLCHLGGFPGPLRKLLGIWAEEIDCLADGERNLIQGLAG
NEAGLQGPYQVRHLCDLIHTEGATALATYRDDFYAGRAAVTVNALGAGKAWYVASRNDLA
FQRDFFGNLISELSLTRALAADFPPGVTAHARHDGESAFIFVENYTGAPQSVTLPEGCAD
MLTGDALSGRLSLAPWGCRILRRRLA
NT seq 2061 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaatttgcgcctttaagtccgaaggtcagcgcccttttgcacggcgcggactac
aacccggagcagtgggagaactaccccggcacggtggagagcgatatcgccatgatgcag
caggcgaaatgcaacgtgatgtcggtgggtattttcagctgggcgaaactggagcctgaa
gaaggcgtgtttcgcttcgagtggctcgacgagattatcgacaagctgtatcagggcggc
attcatgtctttctcgccacgccgagcggcgcgcgtccggcctggatgtcgcaaaaatac
ccgcaggtgctgcgcgtcgggcgcgaccgcgttccggcgctgcatggcggccgtcataac
cactgcatgagttcaccggtctaccgcgacaaaaccgcgaccatcaaccgcctgctggcg
gagcgttacgcgcaccatccggcggtgctcggctggcatatctccaacgaatatggcggc
gagtgtcactgcgatttatgccaggcgaatttccgcggctggctgaaagcgcgctacggc
acgctcgataaactcaacgaggcgtggtggagcaccttctggagccacacctttaccgac
tggtcgcagattgaatccccggcgccgcagggtgaaaacaccattcacggcctgaatctg
gactggcggcgctttaacaccgcgcaggtgaccgatttctgtcgtcacgaactggccccg
ctgaaagcggtgaacccggaattaccggccaccaccaacttcatggagtatttctacgat
tacgactactggcagctcgccgaaccgctcgattttatctcctgggacagctacccgatg
tggcaccgcgataaagacgaaaccgagcttgcctgctataccgcgatgtatcacgacctg
atgcgcacgttaaagcacggtaaaccgtttgtgctgatggaatcgacgccgggcacgacc
aactggcagcccaccagcaagctgaaaaagccggggatgcatattctctcttcactgcag
gcggtggcgcacggcgcggattcggtgcagtacttccagtggcgcaagagccgcggctcg
gtggagaaattccacggcgcggtggtggatcacgtcggccatatcgatacccgtatcggg
cgcgaagtggcgcagcttggcgatatcctaagccagcttgatccggtggccggcgcgcgg
gtagacgcgcaggtggcggtgattttcgactgggaaagccgctgggcgatggacgacgcg
cagggcccgcgcaacctggggctggagtatgaaaagaccgtcgccgagcactaccggccg
ttctgggagcaggggatcgcggtcgatatcattaacgccgacgctgatctgagcgcctat
aagctggttatcgcgccgatgctttacatggtgcgcgacgggtttgcgccgcgcgttgaa
gcctttgtcgaacagggcggccacttcgtgacgacctactggagcggcatcgtcaatgaa
accgatctctgccatctcggcggtttccccggcccgctgcgcaagctgctgggcatctgg
gcggaagagatagactgccttgccgacggcgaacgcaacctgattcaggggctggcgggc
aacgaggcgggcttgcaggggccgtatcaggtgcgccatctgtgcgatctcatccacacc
gaaggcgcgacggcgctcgccacctaccgcgacgatttctatgccggacgcgcggcggtg
acggtgaacgcattaggcgcgggcaaggcctggtatgtggcctcgcgtaacgatcttgcc
ttccagcgcgatttcttcggcaacctcatcagcgagctgtcgctgacgcgcgcgctggcg
gcggatttcccgccgggcgtcaccgcgcatgcccgccacgatggcgaatccgcgtttatc
ttcgttgaaaactacaccggcgcgccgcagtcggtgacgctgccggagggctgcgccgat
atgctgaccggcgatgcgctgagcggcaggctgtcgctcgccccctggggctgccgcatt
ctgcgccgccgcctcgcctga

DBGET integrated database retrieval system