KEGG   Cronobacter turicensis: CTU_05490Help
Entry
CTU_05490         CDS       T00999                                 

Gene name
ganA
Definition
beta-galactosidase galO (EC:3.2.1.23)
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
ctu  Cronobacter turicensis
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:ctu00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    CTU_05490 (ganA)
Enzymes [BR:ctu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     CTU_05490 (ganA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
591217..593277
Genome map
AA seq 686 aa AA seqDB search
MNKFAPLSPKVSALLHGADYNPEQWENYPGTVESDIAMMQQAKCNVMSVGIFSWAKLEPE
EGVFRFEWLDEIIDKLYQGGIHVFLATPSGARPAWMSQKYPQVLRVGRDRVPALHGGRHN
HCMSSPVYRDKTATINRLLAERYAHHPAVLGWHISNEYGGECHCDLCQANFRGWLKARYG
TLDKLNEAWWSTFWSHTFTDWSQIESPAPQGENTIHGLNLDWRRFNTAQVTDFCRHELAP
LKAVNPELPATTNFMEYFYDYDYWQLAEPLDFISWDSYPMWHRDKDETELACYTAMYHDL
MRTLKHGKPFVLMESTPGTTNWQPTSKLKKPGMHILSSLQAVAHGADSVQYFQWRKSRGS
VEKFHGAVVDHVGHIDTRIGREVAQLGDILSQLDPVAGARVDAQVAVIFDWESRWAMDDA
QGPRNLGLEYEKTVAEHYRPFWEQGIAVDIINADADLSAYKLVIAPMLYMVRDGFAPRVE
AFVEQGGHFVTTYWSGIVNETDLCHLGGFPGPLRKLLGIWAEEIDCLADGERNLIQGLAG
NEAGLQGPYQVRHLCDLIHTEGATALATYRDDFYAGRAAVTVNALGAGKAWYVASRNDLA
FQRDFFGNLISELSLTRALAADFPPGVTAHARHDGESAFIFVENYTGAPQSVTLPEGCAD
MLTGDALSGRLSLAPWGCRILRRRLA
NT seq 2061 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaatttgcgcctttaagtccgaaggtcagcgcccttttgcacggcgcggactac
aacccggagcagtgggagaactaccccggcacggtggagagcgatatcgccatgatgcag
caggcgaaatgcaacgtgatgtcggtgggtattttcagctgggcgaaactggagcctgaa
gaaggcgtgtttcgcttcgagtggctcgacgagattatcgacaagctgtatcagggcggc
attcatgtctttctcgccacgccgagcggcgcgcgtccggcctggatgtcgcaaaaatac
ccgcaggtgctgcgcgtcgggcgcgaccgcgttccggcgctgcatggcggccgtcataac
cactgcatgagttcaccggtctaccgcgacaaaaccgcgaccatcaaccgcctgctggcg
gagcgttacgcgcaccatccggcggtgctcggctggcatatctccaacgaatatggcggc
gagtgtcactgcgatttatgccaggcgaatttccgcggctggctgaaagcgcgctacggc
acgctcgataaactcaacgaggcgtggtggagcaccttctggagccacacctttaccgac
tggtcgcagattgaatccccggcgccgcagggtgaaaacaccattcacggcctgaatctg
gactggcggcgctttaacaccgcgcaggtgaccgatttctgtcgtcacgaactggccccg
ctgaaagcggtgaacccggaattaccggccaccaccaacttcatggagtatttctacgat
tacgactactggcagctcgccgaaccgctcgattttatctcctgggacagctacccgatg
tggcaccgcgataaagacgaaaccgagcttgcctgctataccgcgatgtatcacgacctg
atgcgcacgttaaagcacggtaaaccgtttgtgctgatggaatcgacgccgggcacgacc
aactggcagcccaccagcaagctgaaaaagccggggatgcatattctctcttcactgcag
gcggtggcgcacggcgcggattcggtgcagtacttccagtggcgcaagagccgcggctcg
gtggagaaattccacggcgcggtggtggatcacgtcggccatatcgatacccgtatcggg
cgcgaagtggcgcagcttggcgatatcctaagccagcttgatccggtggccggcgcgcgg
gtagacgcgcaggtggcggtgattttcgactgggaaagccgctgggcgatggacgacgcg
cagggcccgcgcaacctggggctggagtatgaaaagaccgtcgccgagcactaccggccg
ttctgggagcaggggatcgcggtcgatatcattaacgccgacgctgatctgagcgcctat
aagctggttatcgcgccgatgctttacatggtgcgcgacgggtttgcgccgcgcgttgaa
gcctttgtcgaacagggcggccacttcgtgacgacctactggagcggcatcgtcaatgaa
accgatctctgccatctcggcggtttccccggcccgctgcgcaagctgctgggcatctgg
gcggaagagatagactgccttgccgacggcgaacgcaacctgattcaggggctggcgggc
aacgaggcgggcttgcaggggccgtatcaggtgcgccatctgtgcgatctcatccacacc
gaaggcgcgacggcgctcgccacctaccgcgacgatttctatgccggacgcgcggcggtg
acggtgaacgcattaggcgcgggcaaggcctggtatgtggcctcgcgtaacgatcttgcc
ttccagcgcgatttcttcggcaacctcatcagcgagctgtcgctgacgcgcgcgctggcg
gcggatttcccgccgggcgtcaccgcgcatgcccgccacgatggcgaatccgcgtttatc
ttcgttgaaaactacaccggcgcgccgcagtcggtgacgctgccggagggctgcgccgat
atgctgaccggcgatgcgctgagcggcaggctgtcgctcgccccctggggctgccgcatt
ctgcgccgccgcctcgcctga

DBGET integrated database retrieval system