KEGG   Cronobacter turicensis: CTU_05590Help
Entry
CTU_05590         CDS       T00999                                 

Gene name
ascB
Definition
cryptic 6-phospho-beta-glucosidase (EC:3.2.1.21 3.2.1.86)
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
ctu  Cronobacter turicensis
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:ctu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CTU_05590 (ascB)
Enzymes [BR:ctu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     CTU_05590 (ascB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
602538..603968
Genome map
AA seq 476 aa AA seqDB search
MDNNTFPEGFLWGGAIAANQAEGAWREGGKGPTTVDMLPHGPNRLAVKLGLDKRVGWRDD
EFYPSHEAIDFYHRYKEDIALMAEMGFTVFRTSIAWSRLYPNGDEQTPNEEGIAFYRALF
SECKKYNIEPLVTLCHFDVPMHLVTEYGSWRSRKMVEFFTRYARTCFEAFDGLVKYWLTF
NEINILLHSPFSGAGLAFEPGENHEQVKYQAAHHELIASAIATRIAHEVNPQNQVGCMLA
GGNFYPYSCKPEDVWAALEKDRENLFFIDVQARGAYPAYTQRLFREKGIVIEKGPEDDEI
LKDTVDFVSFSYYASRCASADMNSQVTNAANIVKSLKNPYIEASEWGWGIDPLGLRITMN
MMYDRYQKPLFLVENGLGAKDAFNENGEIEDDYRISYLREHIRAMREAIEDGIPVMGYTT
WGCIDLVSASTGEMSKRYGFVWVDRDDQGRGTLERKRKKSFWWYKKVIASNGADLD
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atggataacaacacttttcccgaaggatttttatggggcggcgcgattgcggcaaaccag
gcggaaggcgcgtggcgcgagggcggcaaaggccccacgacggtcgatatgctgccgcac
ggcccgaaccgcctggcggtaaagctcgggctcgataagcgcgtcggctggcgcgacgat
gagttttacccgagccacgaggcgatcgatttctatcaccgctataaagaagatatcgcg
ctgatggccgagatgggctttacggtgtttcgcacgtcgatcgcctggagccgtctttac
ccgaacggcgatgaacagacgccgaacgaagagggcatcgccttctaccgcgcgctgttc
agcgagtgcaaaaaatacaacatcgagccgctggtgacgctctgccacttcgacgtgccg
atgcatctggtgacggaatatggctcctggcgcagccgtaaaatggtggagttttttacc
cgctacgcgcgcacctgctttgaagcgttcgacgggctggtgaaatactggcttaccttc
aacgagatcaacattctgctgcacagcccgttctccggcgcaggcctggcgtttgagccg
ggcgaaaaccatgaacaggtgaaataccaggccgcgcaccacgagcttatcgccagcgcc
atcgccacccgcatcgcacatgaagtgaacccccaaaaccaggtgggctgcatgctggcg
ggcggcaacttctacccctactcctgcaagccggaggatgtctgggcggcgctggagaaa
gaccgcgaaaacctgttttttatcgacgtgcaggcgcgcggggcgtacccggcctatacg
cagcgcctgtttcgtgaaaaaggcatcgtgattgaaaaagggccggaggatgacgagatc
cttaaagataccgtcgatttcgtctcgtttagctactacgcctcgcgctgcgcctcggcg
gatatgaacagtcaggtgactaacgccgcgaacatcgtgaaatcgctgaaaaacccgtat
atcgaggcgagcgaatggggctgggggatcgatcctctgggactgcgcatcaccatgaac
atgatgtatgaccgctaccagaaaccgctgttcctggtggaaaacggcctcggcgcgaaa
gacgcctttaatgaaaacggcgaaatcgaagatgactaccgcatcagttatctgcgcgag
cacatccgcgcgatgcgcgaagccattgaagacggcattccggtgatgggctacaccacc
tggggttgcatcgatctggtgtcggcctccaccggcgagatgagcaaacgctacggtttc
gtctgggtggatcgcgacgaccagggccgcggcacgctggagcgcaagcgtaagaaatcg
ttctggtggtataaaaaagtgatcgccagcaacggcgccgatctcgactga

DBGET integrated database retrieval system