KEGG   Siccibacter turicensis: CTU_06320Help
Entry
CTU_06320         CDS       T00999                                 

Gene name
thrC
Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
ctu  Siccibacter turicensis
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:ctu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CTU_06320 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CTU_06320 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    CTU_06320 (thrC)
Enzymes [BR:ctu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     CTU_06320 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
682481..683770
Genome map
AA seq 429 aa AA seqDB search
MKLYNLKDHNEQVSFAQAVTQGLGKNQGLFFPHDLPEFSLTEIDEMLEMDFVSRSSKILS
AYIGDEIPADTLRQRVEKAFTFPAPVSQVAEDIGCLELFHGPTLAFKDFGGRFMAQMLTQ
ISGDKPVTILTATSGDTGAAVAHAFYGLKNVQVVILYPRGKISPLQEKLFCTLGGNIETV
AIDGDFDACQALVKQAFDDEELKTKLGLNSANSINISRLLAQICYYFEAVAQLPQEARNQ
LVVSVPSGNFGDLTAGLLAKSAGLPVKRFIAATNANDTVPRFLQHGEWLPNATVATLSNA
MDVSQPNNWPRVEELFRRKIWRLNELGVATIDDEITKATMRELRELGYLSEPHAAVAYRA
LRDQLRPGEYGLFLGTAHPAKFKESVEEVLGETLELPAELAERVDLPLLSHSLPADFAAL
REFMMSKAP
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgaaactttataatctgaaagatcataacgaacaggtcagctttgcgcaggccgtcacg
cagggactggggaaaaatcaggggctctttttcccgcacgatttaccagaattcagtctg
actgaaatcgatgaaatgctggagatggattttgtctcccgcagcagcaaaattctttcg
gcctatatcggcgatgaaatcccggcggacacgctgcgtcagcgcgtggaaaaggcgttt
accttcccggcgccggtaagccaggtggcggaagatatcggctgtctggagctgttccac
ggcccgaccctggcgtttaaagatttcggcggccgttttatggcgcagatgctgacgcaa
atcagcggcgataaaccagtgaccattctgaccgcgacgtccggcgacacgggggcggca
gtggcccacgcgttttatggtctgaaaaacgtgcaggtggttatcctctatccgcgcggc
aaaatcagcccgctgcaggaaaaactgttctgtacgctcggcggcaatatcgaaacggtc
gccatcgacggcgatttcgacgcctgccaggcgctggtgaaacaggcgtttgatgacgaa
gagctgaaaacgaaacttggccttaactccgctaactccattaatatcagccgcctgctg
gcgcagatttgctactactttgaagctgtcgcgcaactgccgcaggaggcccgcaatcaa
ctggtggtatcggtgccgagcggcaactttggcgacctgaccgccgggctgctggcgaaa
tccgccgggctgccggtgaagcgtttcatcgccgcgacgaacgccaacgatacggtgccg
cgtttcctgcagcatggcgaatggctgccgaatgcgacggtggcgacgctctcgaacgcg
atggatgtgtcacagccgaacaactggccgcgcgtggaagaactcttccgccgtaaaatc
tggcgtctgaacgagctgggtgttgcgaccatcgacgatgaaatcacgaaggcgaccatg
cgcgaactgcgcgagctggggtatttgtcggagccgcacgcggcggtggcttaccgcgcg
ctgcgcgatcagctgcgccctggcgagtacggtctgtttctcggcaccgcgcatccggcg
aaattcaaagagagcgtggaagaggtgcttggtgaaacgctggaactcccggcggagctt
gccgaacgtgtcgatctgccgctgctgtcgcattcgttgccggcggatttcgccgcgctg
cgcgagtttatgatgagcaaagcgccgtaa

DBGET integrated database retrieval system