KEGG   Cronobacter turicensis: CTU_07730Help
Entry
CTU_07730         CDS       T00999                                 

Gene name
folK
Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridinepyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
ctu  Cronobacter turicensis
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ctu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    CTU_07730 (folK)
Enzymes [BR:ctu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     CTU_07730 (folK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(833207..833686)
Genome map
AA seq 159 aa AA seqDB search
MTLAFIALGSNLAEPLSQVNNALAALARIPHSRIVATSSFYRTPPLGPQDQPDYLNAAVA
LETTLSAEELLDNTQRIELEQGRVRKAERWGPRTLDLDIMLFGDATINTERLTVPHYDMK
NRAFMLLPLSEIAPALRFPDGERLADVLKRLDCSAIRHW
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
gtgacgctggcctttatcgcgctcggcagcaatcttgccgagccgctttctcaggtcaat
aacgcgctggccgcgctggcgcgtattcctcacagccgcattgtggccacctcttctttt
tatcgcaccccgccgcttggcccgcaggatcagcccgattacctgaatgccgccgtggcg
ctggagacgacgcttagcgccgaagaacttctcgataacacgcagcgcattgagcttgag
caggggcgcgtgcgtaaagcggagcgctggggcccgcgtacgctcgatctcgacatcatg
ctgtttggcgacgcgacgataaacaccgagcggctgaccgttccccactacgacatgaaa
aaccgcgcctttatgctgctgccgctttcagagatagcgcccgcgctgcgcttcccggat
ggcgagcgtctggccgatgtgctcaaacgccttgattgttcagcaattcgccactggtaa

DBGET integrated database retrieval system