KEGG   Cronobacter turicensis: CTU_08010Help
Entry
CTU_08010         CDS       T00999                                 

Gene name
dxr
Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase (EC:1.1.1.267)
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
ctu  Cronobacter turicensis
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:ctu00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CTU_08010 (dxr)
Enzymes [BR:ctu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     CTU_08010 (dxr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
866764..867993
Genome map
AA seq 409 aa AA seqDB search
MRLFLFHVERLMKHLTILGSTGSIGCSTLDVIRHNPDKFAVTALVAGKNVARMVEQCLEF
RPRFAVMDDEASARELRDTLREQGSRTEVLAGRDAACEMASLDEVTQVMAAIVGAAGLLP
TLAAIAAGKQVLLANKESLVTCGRLFMEAVARSGAQLLPVDSEHNAIFQSLPATIQHNLG
YAKLEESGVSSIILTGSGGPFRQTPLPELAAMTPDQACRHPNWSMGRKISVDSATMMNKG
LEYIEARWLFNARADQMEVLIHPQSVIHSMVRYADGSVLAQLGEPDMRTPIAHTMAWPAR
VPSGVTHLDFCKIATLSFGEPDYQRYPCLKLAIDAFEKGQAATTALNAANEITVAAFLAG
EIRFTDIAALNQAVLDEMDLREPQSVDEVLTVDAEARTVAHNRVMRLAS
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
gtgcgtttattcttatttcacgttgagcgcctcatgaagcatttaaccattctcggctct
accggctctatcggttgcagcacccttgatgttatccgtcataatccggacaagtttgcg
gttaccgcgctggtggcgggcaagaatgtcgcccgaatggttgaacaatgtctggagttc
cgcccgcgtttcgcggtgatggatgatgaggcgagcgcccgtgaactgcgtgacacgctg
cgcgagcagggcagccgcactgaagtattagccgggcgcgacgcggcctgcgagatggcg
tcgcttgatgaggtgacgcaggtgatggcggccatcgtcggcgccgctgggctgctgccg
acccttgccgctatcgcggccggtaagcaagtgttactggcgaataaagaatcgctggtg
acctgcggacgcctttttatggaggcggtcgcgcgcagcggggcgcaactgctgccggtg
gatagcgagcataacgcgatttttcagagtttaccggcaacaattcaacacaacctgggg
tacgctaaacttgaggaaagcggagtttcttcgattatcctcaccggatctggtggaccg
tttcgacagacgcctttgcctgaactggcggcaatgacgccggaccaggcgtgtcgtcat
cctaactggtcgatggggcgtaaaatatccgtcgattcggctaccatgatgaataaaggt
ctcgaatacattgaagctcgctggctatttaacgcccgggcagaccagatggaagtgttg
attcatccacagtcggtgattcattccatggtgcgctatgccgacggcagcgtgctggca
caactgggcgaacccgatatgcgcacccccatcgcgcatacgatggcctggccagcgcgt
gtcccttccggcgtgacgcatctggatttttgcaagatagcgacgctgagcttcggcgaa
ccggattatcagcgctatccgtgtctgaagctcgccattgacgcctttgaaaaagggcag
gcggcgacgacagcgcttaacgcggcgaatgagattacggtcgccgcttttcttgccgga
gagattcgttttacggatatcgcagcgcttaatcaggcggtgctggatgaaatggatctt
cgtgaaccgcaaagtgtggatgaagtgctcaccgtagatgccgaagcgcgcactgttgcg
cataatcgggtgatgcgtctcgcaagctga

DBGET integrated database retrieval system