KEGG   Cronobacter turicensis: CTU_10790Help
Entry
CTU_10790         CDS       T00999                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
ctu  Cronobacter turicensis
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:ctu00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    CTU_10790 (recR)
DNA repair and recombination proteins [BR:ctu03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      CTU_10790 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1162048..1162653
Genome map
AA seq 201 aa AA seqDB search
MQTSPLLTQLMEALRCLPGVGPKSAQRMAFTLLQRDRSGGMRLAQALTRAMSEIGHCADC
RTFTEQEKCNICTNPRRQENGQICVVESPADIHAIEQTGQFSGRYFVLMGHLSPLDGIGP
DDIGLDRLEQRLEAEPLKEIILATNPTVEGEATANYIAELCGQYGVDASRIAHGVPVGGE
LEMVDGTTLSHSLAGRHKMTF
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgcagaccagtcctctgctgactcaactgatggaagcgctgcgctgcctgccgggtgtc
ggcccgaaatcggcgcagcgcatggcgtttacgctgctgcaacgcgatcgcagcggcggg
atgcgccttgctcaggcgctaacccgcgccatgtcggaaatcggtcactgcgccgactgc
cgcaccttcactgagcaggaaaaatgtaatatctgcaccaatccgcgccgtcaggaaaac
ggacagatctgcgtggtggaaagcccggcggatatccacgccatcgagcagaccggccag
ttctccggccgctacttcgtgctgatgggccatctttcgccactcgacggtatcggcccg
gacgatatcggccttgaccgtctggagcagcgtctggaagcggaacccttaaaagagatt
attctcgccaccaacccgacggtggaaggcgaggcgaccgcgaactacatcgccgagctc
tgcggccagtatggcgttgacgcaagccgcatcgcgcacggcgtgccggtgggcggcgag
ctggagatggtggatggcacgacgctgtcgcactcgctggccggacgccataagatgaca
ttttaa

DBGET integrated database retrieval system