KEGG   Cronobacter turicensis: CTU_11950Help
Entry
CTU_11950         CDS       T00999                                 

Gene name
gpo
Definition
glutathione peroxidase (EC:1.11.1.15 1.11.1.9)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
ctu  Cronobacter turicensis
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:ctu00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    CTU_11950 (gpo)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    CTU_11950 (gpo)
Enzymes [BR:ctu01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     CTU_11950 (gpo)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1252245..1252736)
Genome map
AA seq 163 aa AA seqDB search
MEEPVMTPFHQLTATSLRGELISMADYAGKLILVVNTASHCGFTPQYAGLEALYKQYAAR
GLVVLGFPCNQFGHQEPGGADEIAQTCHINYGVSFPMFEKVEVNGTATHPVFRYLKDELP
GVLGGRIKWNFTKFLIGRDGKPLRRFAPFTTPEKIETVILTAL
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
attgaggagcccgtcatgaccccctttcatcaactgactgccaccagcctgcgcggcgag
ctcatctctatggccgactacgctggcaagctgattctggtggttaataccgccagccat
tgcggctttacgccacaatacgcgggccttgaagcgctgtataagcagtacgccgcccgg
ggtctggttgtgcttggtttcccctgcaaccagttcggtcatcaggaacccggcggtgcc
gatgaaatcgcgcagacctgtcatatcaactacggtgtgagcttccccatgttcgagaaa
gtggaggtcaacggcaccgctacgcacccggtgtttcgttacctgaaagacgaattaccc
ggcgtgttaggtggacgaatcaaatggaacttcactaagtttttgatcggacgcgacggc
aaaccgctcagacgttttgccccgtttacgacccctgagaaaatagaaacggtcattctt
acagcgctataa

DBGET integrated database retrieval system