KEGG   Cronobacter turicensis: CTU_12710Help
Entry
CTU_12710         CDS       T00999                                 

Gene name
cobC
Definition
alpha-ribazole phosphatase (EC:3.1.3.73)
Orthology
K02226  
alpha-ribazole phosphatase [EC:3.1.3.73]
Organism
ctu  Cronobacter turicensis
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ctu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CTU_12710 (cobC)
Enzymes [BR:ctu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.73  adenosylcobalamin/alpha-ribazole phosphatase
     CTU_12710 (cobC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1338891..1339511)
Genome map
AA seq 206 aa AA seqDB search
MKLWLVRHGQTEANVAGLYSGHAETALTPVGVTQAQAVGTMLRDVAFDRVLCSALGRAQH
TARLVLDGRYESIETDPRLNEMFFGDWEMRHHRDLLLEDPEAYRAWCADWQNAVPTNGES
FTAFAARVDAFIETLSAPQEAENILIVSHQGVLSLLIARLLDMPGRSLWHFLLEQGAWSR
VARYDGFTQLQTLNNRAPWRPSADAR
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgaaactctggctggtacgtcacggacaaaccgaagcgaacgtcgcaggcctctacagc
ggccatgcggaaaccgcgctgacgcccgtcggcgtcacgcaggcgcaggcggtcggcact
atgctccgcgacgtggcttttgaccgtgtattgtgcagcgcgctgggccgcgcgcaacac
accgcccgccttgttctcgacggccgctatgaaagcatcgaaaccgacccgcgtctgaac
gagatgttttttggcgactgggagatgcgccaccaccgcgatttactgctggaagatcct
gaagcttatcgcgcctggtgcgcagactggcaaaacgccgtacccaccaatggcgaaagc
ttcaccgcgtttgccgcgcgggtggatgcgtttattgagacgctgagcgcgccgcaggag
gctgagaatatccttatcgtcagccatcagggcgtgctgagcttgctgattgcccgcctg
cttgatatgccgggccgctcgctgtggcatttcctgctggagcaaggggcatggagccgt
gtagcgcgttatgacggcttcacgcagttgcagacgttaaacaaccgcgcgccgtggcgt
ccttctgctgacgcgcgctga

DBGET integrated database retrieval system