KEGG   Cronobacter turicensis: CTU_12880Help
Entry
CTU_12880         CDS       T00999                                 

Gene name
asnB
Definition
(GenBank) Asparagine synthetase B [glutamine-hydrolyzing]
  KO
K01953  asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
ctu  Cronobacter turicensis
Pathway
ctu00250  Alanine, aspartate and glutamate metabolism
ctu01100  Metabolic pathways
ctu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ctu00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CTU_12880 (asnB)
Enzymes [BR:ctu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     CTU_12880 (asnB)
Peptidases [BR:ctu01002]
 Cysteine Peptidases
  Family C44
   CTU_12880 (asnB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asn_synthase GATase_7 GATase_6 DUF3700 NAD_synthase tRNA_Me_trans
Motif
Other DBs
NCBI-ProteinID: CBA29184
UniProt: C9XZ61
Position
complement(1356996..1358660)
Genome map
AA seq 554 aa AA seqDB search
MCSIFGVLDIKTDAVELRKKALELSRLMRHRGPDWSGVFASDKAILAHERLSIVDVNAGA
QPLYNTEKTHVLAVNGEIYNHQALRAEYGERFQFQTGSDCEVILALYQEKGPEFLDELQG
MFAFVLYDSEKDAYLIGRDHIGIIPLYMGHDEHGNFYVASEMKSLVPVCRTIKEFPAGSY
LWSQDGEIRQYYQRDWFDYDAVKDNVTDKAELRQALEDAVKSHLMSDVPYGVLLSGGLDS
SVISAITKKFAARRVEDQERSEAWWPQLHSFAVGLEGSPDLKAAQEVANHLGTVHHEIHF
TVQEGLDAIRDVIYHIETYDVTTIRASTPMYLMSRKIKAMGIKMVLSGEGSDEVFGGYLY
FHKAPNAKELHEETVRKLQALHMFDCARANKAMSAWGVEARVPFLDKKFLDVAMRINPQD
KMCGNGKMEKHILRECFESYLPASVAWRQKEQFSDGVGYSWIDTLKEVAAKQISDQQLET
ARFRFPYNTPASKEAYLYREIFEELFPVPSAAECVPGGPSVACSSAKAIEWDEAFKTMND
PSGRAVGVHQSAYK
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atgtgttctatttttggtgtgctggatatcaaaaccgacgcggtcgaactgcgtaaaaaa
gcgcttgagctgtcgcgcctgatgcgccaccgcggcccggactggtccggcgtcttcgcc
agcgacaaagcgatcctcgcgcatgaacggctctccatcgtggacgtcaacgcaggcgcg
cagccgctctacaacactgagaaaacgcacgtgctggccgttaacggcgaaatctataac
catcaggcgctgcgcgcggaatatggcgagcgtttccagttccagaccggctctgactgc
gaagtcatcctcgcgctgtatcaggaaaaaggcccggagtttctggacgagttgcagggc
atgttcgccttcgtgctttatgacagcgaaaaagacgcgtacctgattggccgcgatcat
atcggcattattccgctttatatgggccacgatgaacacggcaacttttatgtcgcctcc
gaaatgaaatcgctggtgccggtctgccgcactatcaaagagttcccggcgggcagctac
ctgtggagccaggacggcgaaattcgccagtactatcagcgtgactggtttgactatgac
gcggtgaaagataacgtgacggacaaagcggagctgcgccaggccctggaagatgcggtt
aaaagccatctgatgtctgacgtgccttacggcgtgctgctctccggcggcctggattct
tcggtcatttccgccattaccaagaaattcgcggcgcgccgcgtggaagatcaggagcgc
tccgaagcctggtggccgcagctgcactcctttgccgttggccttgaaggctcgccggat
ctgaaagccgcgcaggaagtcgccaaccatctcggcacggtacaccatgaaattcacttt
accgtgcaggaaggactcgatgcgatccgcgacgtgatttaccacatcgaaacctatgac
gtgaccacgattcgcgcctcaaccccgatgtatttgatgtcccgtaaaatcaaagcgatg
ggcatcaaaatggtgctttccggcgaaggttcagacgaagtgttcggcggctatctttac
ttccataaagcgccgaacgcgaaagagctgcatgaagagaccgtccgcaagttgcaggcg
ctgcatatgtttgactgcgcgcgtgcgaacaaagcgatgtcggcctggggcgttgaggcg
cgcgtgccgttcctcgataagaaattccttgatgtggcgatgcgtatcaacccgcaggat
aaaatgtgcggcaacggcaagatggaaaaacatatcctgcgtgaatgttttgaatcttat
ttgccggcgagcgtggcatggcgtcagaaagagcaattctccgacggcgtgggctatagc
tggattgataccctgaaagaagtggcggcgaaacagatttccgatcagcagctggaaacc
gcgcgcttccgcttcccgtataacacgccagcgtcgaaagaagcgtatctctaccgcgag
atcttcgaagagttgttcccggtgccgagtgcggcggagtgcgtgcctggcgggccgtcc
gtcgcctgctcttccgcgaaagctatcgaatgggacgaagcgtttaaaaccatgaacgat
ccgtcaggccgtgcggtgggcgtacaccagtctgcctataaataa

DBGET integrated database retrieval system