KEGG   Cronobacter turicensis: CTU_12990Help
Entry
CTU_12990         CDS       T00999                                 

Gene name
chb
Definition
Chitobiase (EC:3.2.1.52)
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
ctu  Cronobacter turicensis
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:ctu00520]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:ctu00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1369426..1372134
Genome map
AA seq 902 aa AA seqDB search
MAQGRAQAPYIKGSEKDTMMKKLQVSLLAGAVMGLFSGTGAQASTAEHISQFGLNYAITD
NQAAQHGTDCAALGADWASCNKAVITLTNPGDAVTEKNWTIWFHSIRQILKVDNDQFKVT
HVMGDLHKLEPTDKFTGFPAKASVEIPIINEYWQLFITDVLPRWYVTADDGAPKVIASTD
TETLTDFVSPLKDQWKRTADDKNILMTAEARFDKNSDVKTLNAEHLRGQIVPTPRHVEVH
GQNVSLDKGVQLFLSALDKPAQEAITARFALLGVKTDAGYPVRTAIDSKAFTGKEAVSGA
YQLHIGPQETTITGYDRAGVFYGLQSLLSLIPAEGARQIATLDAQDAPRFDYRGIHLDVG
RNFHTKAAVLRLLDQMAAYKLNKFHFHLSDDEGWRLEIPGLPELTDVGAKRCHDLSEKTC
LLPQLGSGPDTNNNGSGYFTRADYIEIVKYAAARQIEVVPEIDMPAHARAAVVAMEARYD
KLEKAGKTEEANQYRLLDPDDTSVTTGVQYYNRTGYLNPCLDSSRRFVDKVIGEIQQMHR
EAGQPLSTWHFGGDEAKNIYLGAGYTDKAKPEAGKGIIDQSRQDKPWARSPVCQKMVQDG
VVTDVDHLSSYFGIEVSKLVKAHGIDTMQAWQDGLKDAKDVSAFATSHVNVNFWDTLYWG
GFDTVNDWANKGFRVVVSNPDYVYLDFPNEVNPAESGYYWGTRFSDERKIFSFAPDNLPQ
NAETSVDRDGNAFSAKSDKPWPGAYGLSAQLWSEVVRTDKQMEYMMYPRLLAVAERAWHR
AAWEQDYQAGREYKGGETHLVDVKALHDDWTRFANLTGSRELPKLEKAGVQFRLPVPGAR
VKEGVLRMNISLPGVAMEYSTDGGARWQRYDAAKPPRVAGAVQVRSVSSDGKRYSRVENV
QL
NT seq 2709 nt NT seq  +upstreamnt  +downstreamnt
attgcgcaggggcgcgcgcaggcgccttacataaagggcagtgaaaaggacacgatgatg
aaaaaattacaggtcagtctgttagcgggtgcggtaatggggcttttttccggtaccggc
gcacaggcgtcaacggcagaacacatcagccagtttgggctcaattatgcgattaccgac
aatcaggccgcgcagcacggcacagactgcgcggcgctgggcgccgactgggcgtcatgc
aataaagcggttatcacgctcaccaatccaggcgatgcggtaacggaaaaaaactggact
atctggtttcacagcattcgccagatcctcaaagtcgataacgatcagtttaaagtgacc
cacgtgatgggcgatctccacaagcttgagccgacggacaaatttaccggcttcccggcg
aaagcgtcggtggagatcccgattattaatgagtactggcaactgtttatcaccgacgta
ttgccgcgctggtatgtcacggcagacgacggcgcgccgaaggttatcgccagtaccgat
accgaaacgttaactgacttcgtcagcccgctaaaagatcagtggaaacgcacggcggat
gataaaaacattctgatgaccgccgaagcgcgattcgacaaaaacagtgacgtcaaaacc
ctgaatgcagagcatctgcgcgggcagatcgtgcctacgccgcgccacgttgaagtacac
ggacaaaacgtctcactcgataagggcgttcagctctttctctccgcactggataaaccc
gcgcaggaggcgattaccgcccgttttgcgctgctcggcgtgaaaaccgacgcggggtat
ccggtgcggacagccatcgacagcaaggcgtttaccggcaaagaggcggtgtccggcgcg
tatcagctgcatatcgggccacaagagacgacgattaccggctatgaccgcgcaggcgtt
ttttatgggctgcaatcgctgctctcgctgatcccggcggagggcgccaggcagatagcg
acgctggacgcccaggacgcgccgcgttttgactatcgcggcattcaccttgatgtgggg
cgcaacttccacaccaaagcggccgtgctgcgtctgcttgaccagatggcggcctataag
ctcaataaattccacttccatctgagcgatgacgaaggctggcgtcttgaaataccgggt
ttgccggaactgactgacgtgggcgcgaagcgctgccacgatctcagcgaaaaaacctgc
ctgctgccgcagctcggctccgggccggacaccaacaataacggcagcgggtatttcacg
cgtgcggattatattgagatagtgaaatatgccgctgcgcgccagatagaagtggtcccg
gaaatcgatatgcccgcgcacgcccgcgcggcggttgtcgcgatggaagcgcgttacgac
aaactggaaaaagcgggcaaaaccgaagaggcgaatcaatatcgtctgctcgatcctgac
gatacgtcggtcaccactggcgtgcagtactacaaccgcaccggctacctcaacccatgc
ctcgactcgtcgcgccgcttcgtggataaagtgattggcgagatccagcagatgcacaga
gaggccggacaaccgctcagcacctggcatttcggcggcgatgaggccaaaaatatctac
ctcggggcgggctatacggacaaagcgaaaccagaggccggaaaggggattatcgaccag
agccgtcaggacaagccctgggcgcgctcgccggtatgccagaaaatggtgcaggacggc
gtagtgactgatgtcgaccatctttccagttactttggtattgaagtcagtaagctcgtc
aaagcccacggcatcgacaccatgcaggcgtggcaggatggcctaaaagatgcgaaagac
gtcagcgcgtttgctacctcgcacgtcaacgtcaacttctgggatacgctctactggggc
ggctttgatacggtgaacgactgggcgaataaaggttttcgtgtcgtggtctctaacccg
gactacgtctatctcgatttcccgaacgaagtgaatccggcggagagcggctattactgg
ggcacgcgctttagcgacgagcgcaagattttcagcttcgcgccagataacctgccgcaa
aacgcagagacttccgttgatcgcgatggcaatgcattcagcgccaaatccgacaagccg
tggccgggcgcgtatggcctctcggcgcagctctggagcgaagtcgtgcgcaccgataag
cagatggagtacatgatgtacccgcgtctgctggccgtcgcggagcgcgcctggcatcgc
gccgcctgggagcaggattatcaggcgggtcgcgaatataaaggcggcgaaacgcatctg
gtggatgtgaaagcgctgcacgacgactggacgcgctttgcgaacctgaccggcagccgc
gaactgccgaagcttgaaaaagcgggcgtgcagttccgtttaccggtgcccggcgcgcgc
gttaaagagggcgtgttgcggatgaacatcagcctgcctggcgtcgcaatggagtattcc
accgacggcggcgcgcgctggcagcgttatgacgccgcgaagccgccacgcgtcgcaggc
gcggtgcaggtgcgaagcgtcagcagcgacggcaaacgttacagccgtgtggagaatgta
cagctgtaa

DBGET integrated database retrieval system