KEGG   Cronobacter turicensis: CTU_13290Help
Entry
CTU_13290         CDS       T00999                                 

Gene name
sdhD
Definition
(GenBank) Succinate dehydrogenase hydrophobic membrane anchor subunit
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
ctu  Cronobacter turicensis
Pathway
ctu00020  Citrate cycle (TCA cycle)
ctu00190  Oxidative phosphorylation
ctu00650  Butanoate metabolism
ctu01100  Metabolic pathways
ctu01110  Biosynthesis of secondary metabolites
ctu01120  Microbial metabolism in diverse environments
ctu01130  Biosynthesis of antibiotics
ctu01200  Carbon metabolism
Module
ctu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ctu_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
ctu_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:ctu00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CTU_13290 (sdhD)
   00650 Butanoate metabolism
    CTU_13290 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    CTU_13290 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS
Motif
Other DBs
NCBI-ProteinID: CBA29265
UniProt: C9XZA2
Position
1403298..1403645
Genome map
AA seq 115 aa AA seqDB search
MVSNASALGRNGVHDFILVRATSIVMTLYIIYMIGFFAMNGDLTYEVWTGFFSSTFTKVF
TLLTLVSILVHTWIGMWQVLTDYVKHLALRLFLQLAIVVALVVYVIYGFVVVWGV
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atggtaagcaacgcctccgcattaggacgcaacggcgtacatgacttcatcctggttcgc
gccacctctatcgtaatgacgctgtatatcatctatatgattggcttcttcgcgatgaat
ggcgacctgacatatgaagtctggactggtttcttctcatccaccttcaccaaagtattc
accctgctgaccctggtttcgattctcgtccatacctggattgggatgtggcaggtgctg
accgactatgtaaaacatctggcgctgcgcctctttttgcagctggcgattgtcgtcgct
ctggtggtttacgtgatttatggctttgttgtggtgtggggtgtgtaa

DBGET integrated database retrieval system