KEGG   Cronobacter turicensis: CTU_13680Help
Entry
CTU_13680         CDS       T00999                                 

Gene name
ybhC
Definition
acyl-CoA thioesterase (EC:3.1.1.11)
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
ctu  Cronobacter turicensis
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ctu00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    CTU_13680 (ybhC)
   00500 Starch and sucrose metabolism
    CTU_13680 (ybhC)
Enzymes [BR:ctu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     CTU_13680 (ybhC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1446809..1447990)
Genome map
AA seq 393 aa AA seqDB search
MLSADEAKNFVPARYFANTDPNAAPWSPSPIRLPEQADFVVGQAGEQGVTHTSIQAAVDA
AIARHASARQYIAILPGTYEGTVYVPAAPGSVTLYGTGEKPLDVKISAALDSEMDANTWR
RTVNPSGKYMPGKPAWYMFDNCQNHRNGSVGLMCSAVFWSQNNGLQLQNLTIENSLGDAA
GEGQHQAVALRTDGDRVQINKVNILGRQNPFLVTNSDIRNRFTPDRLTRTQVTNSYVEGD
VDLVAGRGAVVFDNTDFRVVNTRTQKEGYVFAPATMPNFYFGFLAVNSRFVAAGEGVAQL
GRAWDMDASANGYTPGQTPNGQVVIRDSVIDAGFNTAQPWGPALGSQRPFTGNTGAQDDK
GNIQRDLNDANANRLWEYNNRGLGSKVVAEPKK
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
gtgctgtctgcggatgaagcgaaaaatttcgtcccggcccgctatttcgccaataccgat
ccgaatgccgcgccgtggtcgccctccccgattcgcctgcctgaacaagcggacttcgtg
gtcggccaggcgggcgagcagggcgtgacccataccagcattcaggcggcggttgacgca
gccattgcccgtcacgcctcagcgcgccagtacatcgcgatccttccgggcacctacgaa
ggcaccgtttacgtgcctgcggcgccgggcagcgtcacgctttacggcaccggcgaaaaa
ccgcttgatgtgaaaatcagcgccgcgctggacagcgaaatggatgccaacacctggcgt
cgtaccgtgaacccgtccggtaaatatatgcctggcaaaccggcctggtatatgttcgac
aactgccagaaccaccgcaacggcagcgtcggcctgatgtgctccgccgtgttctggtca
cagaataatggtctgcaactgcagaacctgaccatcgaaaacagcctcggcgacgccgcg
ggcgaaggccagcaccaggctgtcgcgctgcgtaccgatggcgatcgcgtgcagatcaac
aaagtgaatatcctgggccgccagaatccgttcctggtgaccaacagcgatatccgcaac
cgcttcacgccggatcgtctgacccgcacgcaggtgactaacagctacgtggaaggcgat
gtggatctggtcgcgggtcgcggcgcggtggtgtttgataacaccgacttccgcgtggtg
aatacccgtacgcagaaagaaggctatgtcttcgcaccggcgactatgccgaatttctat
ttcggtttcctcgccgtgaacagccgctttgtggccgctggtgaaggcgtggcgcaactg
ggccgcgcctgggatatggatgcgagcgccaacggctatacgccaggccagacgccaaac
ggccaggtggttatccgcgacagcgtgattgacgccggtttcaacaccgcgcagccgtgg
ggcccggcgctgggctcacagcgtccgttcaccggtaacaccggcgcgcaggacgacaaa
ggcaatatccagcgcgatctgaacgatgcgaacgccaatcgtctgtgggaatacaacaac
cgcgggctgggcagcaaagtggttgccgaaccgaaaaagtaa

DBGET integrated database retrieval system