KEGG   Cronobacter turicensis: CTU_13710Help
Entry
CTU_13710         CDS       T00999                                 

Gene name
bioA
Definition
adenosylmethionine--8-amino-7-oxononanoate transaminase (EC:2.6.1.62)
Orthology
K00833  
adenosylmethionine-8-amino-7-oxononanoate aminotransferase [EC:2.6.1.62]
Organism
ctu  Cronobacter turicensis
Pathway
Biotin metabolism
Metabolic pathways
Module
Biotin biosynthesis, pimeloyl-ACP/CoA => biotin
Brite
KEGG Orthology (KO) [BR:ctu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    CTU_13710 (bioA)
Enzymes [BR:ctu01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.62  adenosylmethionine---8-amino-7-oxononanoate transaminase
     CTU_13710 (bioA)
Amino acid related enzymes [BR:ctu01007]
 Aminotransferase (transaminase)
  Class III
   CTU_13710 (bioA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1449470..1450762)
Genome map
AA seq 430 aa AA seqDB search
MLTPADLAFDRDHIWHPYTSMSAPLPVYPVTHAAGCELHLASGERLVDGMSSWWAAIHGY
NHPRLNAAMKNQIDAMSHVMFGGVTHPAAIALCRKLVAMTPERLECVFLADSGSVAVEVA
MKMALQYWHARGEPRQRFLTFRHGYHGDTFGAMSVCDPDNSMHSLWKGYLPENLFAPAPQ
SRFDGEWDERDLAPFARLLAAHRQEIAAVILEPVVQGAGGMRMYHPEWLKRIRRMCDREG
ILLIADEIATGFGRTGKLFACEHAGITPDILCLGKALTGGTMTLSATLTTRHVADTISNG
EAGCFMHGPTFMGNPLACAVATESLALLETGEWRSQVAAIERQLRDDLAPCRELPMVADV
RVLGAIGVVETTAPVEMAALQRFFVEQGVWVRPFGRLIYLMPPYIITPEQLTRLTCAVCD
AVKNPSFFRR
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgttaacacccgccgatctcgccttcgatcgtgaccatatctggcacccttacacctcc
atgagcgcgccgctgccggtctacccggtgacgcacgccgctggctgcgaattgcatctg
gcgagcggcgaacggctggtggatggtatgtcctcgtggtgggccgccattcacggctat
aaccatccgcgcctcaacgcggccatgaaaaaccagattgacgcgatgtcgcacgtgatg
ttcggcggcgtcacccatcccgccgcgatagccctgtgccgcaagctggtggcgatgacc
ccggagcgcctggagtgcgtgtttcttgccgactccggttcggtggcggtggaagtggcg
atgaaaatggcgttgcagtactggcacgcccgcggcgagccgcgtcagcgctttctgacc
ttccgccacggctaccacggcgacacctttggggcgatgtcggtgtgcgatccggataac
tcgatgcacagtctctggaagggttatctgccggaaaacctcttcgcgcccgcgccgcag
agccgttttgacggcgagtgggatgagcgcgatctcgcgccgttcgcccgtctgctggcc
gcgcaccgccaggagatagccgcagtcattctcgaacccgttgtgcagggcgcgggcggc
atgcggatgtatcacccggagtggcttaagcgcattcgccgcatgtgcgaccgcgaaggg
attttgcttatcgccgatgagatagcgaccggctttggccggaccggaaagctgttcgcc
tgtgaacacgccgggataacgccggatattctctgcctcggcaaggcgctgaccggcggc
acgatgacgctttccgccaccctcaccacgcggcatgtcgccgacaccatcagtaacggc
gaggcgggctgctttatgcatggcccgacgtttatgggcaatccgctcgcctgcgcggtg
gctaccgagagtctggcgctgctggaaaccggcgagtggcgctcacaggtggcggctatt
gagcggcagttgcgtgacgacctggcgccgtgtcgcgaattgccgatggtcgctgacgtg
cgcgtgctgggcgctatcggcgtcgtggaaaccaccgcgccggtcgagatggccgcgctt
cagcgctttttcgtggaacagggcgtctgggtgcgcccgtttggccgcctgatttacctg
atgccgccttatatcattacgcctgaacagctcacgcgtctcacctgcgcggtgtgtgac
gccgtgaaaaacccgtcgtttttcagacgctga

DBGET integrated database retrieval system