KEGG   Cronobacter turicensis: CTU_13710Help
Entry
CTU_13710         CDS       T00999                                 

Gene name
bioA
Definition
adenosylmethionine--8-amino-7-oxononanoate transaminase (EC:2.6.1.62)
Orthology
K00833  
adenosylmethionine-8-amino-7-oxononanoate aminotransferase [EC:2.6.1.62]
Organism
ctu  Cronobacter turicensis
Pathway
Biotin metabolism
Metabolic pathways
Module
Biotin biosynthesis, pimeloyl-ACP/CoA => biotin
Class
Metabolism; Metabolism of cofactors and vitamins; Biotin metabolism [PATH:ctu00780]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1449470..1450762)
Genome map
AA seq 430 aa AA seqDB search
MLTPADLAFDRDHIWHPYTSMSAPLPVYPVTHAAGCELHLASGERLVDGMSSWWAAIHGY
NHPRLNAAMKNQIDAMSHVMFGGVTHPAAIALCRKLVAMTPERLECVFLADSGSVAVEVA
MKMALQYWHARGEPRQRFLTFRHGYHGDTFGAMSVCDPDNSMHSLWKGYLPENLFAPAPQ
SRFDGEWDERDLAPFARLLAAHRQEIAAVILEPVVQGAGGMRMYHPEWLKRIRRMCDREG
ILLIADEIATGFGRTGKLFACEHAGITPDILCLGKALTGGTMTLSATLTTRHVADTISNG
EAGCFMHGPTFMGNPLACAVATESLALLETGEWRSQVAAIERQLRDDLAPCRELPMVADV
RVLGAIGVVETTAPVEMAALQRFFVEQGVWVRPFGRLIYLMPPYIITPEQLTRLTCAVCD
AVKNPSFFRR
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgttaacacccgccgatctcgccttcgatcgtgaccatatctggcacccttacacctcc
atgagcgcgccgctgccggtctacccggtgacgcacgccgctggctgcgaattgcatctg
gcgagcggcgaacggctggtggatggtatgtcctcgtggtgggccgccattcacggctat
aaccatccgcgcctcaacgcggccatgaaaaaccagattgacgcgatgtcgcacgtgatg
ttcggcggcgtcacccatcccgccgcgatagccctgtgccgcaagctggtggcgatgacc
ccggagcgcctggagtgcgtgtttcttgccgactccggttcggtggcggtggaagtggcg
atgaaaatggcgttgcagtactggcacgcccgcggcgagccgcgtcagcgctttctgacc
ttccgccacggctaccacggcgacacctttggggcgatgtcggtgtgcgatccggataac
tcgatgcacagtctctggaagggttatctgccggaaaacctcttcgcgcccgcgccgcag
agccgttttgacggcgagtgggatgagcgcgatctcgcgccgttcgcccgtctgctggcc
gcgcaccgccaggagatagccgcagtcattctcgaacccgttgtgcagggcgcgggcggc
atgcggatgtatcacccggagtggcttaagcgcattcgccgcatgtgcgaccgcgaaggg
attttgcttatcgccgatgagatagcgaccggctttggccggaccggaaagctgttcgcc
tgtgaacacgccgggataacgccggatattctctgcctcggcaaggcgctgaccggcggc
acgatgacgctttccgccaccctcaccacgcggcatgtcgccgacaccatcagtaacggc
gaggcgggctgctttatgcatggcccgacgtttatgggcaatccgctcgcctgcgcggtg
gctaccgagagtctggcgctgctggaaaccggcgagtggcgctcacaggtggcggctatt
gagcggcagttgcgtgacgacctggcgccgtgtcgcgaattgccgatggtcgctgacgtg
cgcgtgctgggcgctatcggcgtcgtggaaaccaccgcgccggtcgagatggccgcgctt
cagcgctttttcgtggaacagggcgtctgggtgcgcccgtttggccgcctgatttacctg
atgccgccttatatcattacgcctgaacagctcacgcgtctcacctgcgcggtgtgtgac
gccgtgaaaaacccgtcgtttttcagacgctga

DBGET integrated database retrieval system