KEGG   Cronobacter turicensis: CTU_18360Help
Entry
CTU_18360         CDS       T00999                                 

Gene name
pfkB
Definition
(GenBank) 6-phosphofructokinase isozyme 2
  KO
K16370  6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
ctu  Cronobacter turicensis
Pathway
ctu00010  Glycolysis / Gluconeogenesis
ctu00030  Pentose phosphate pathway
ctu00051  Fructose and mannose metabolism
ctu00052  Galactose metabolism
ctu00680  Methane metabolism
ctu01100  Metabolic pathways
ctu01110  Biosynthesis of secondary metabolites
ctu01120  Microbial metabolism in diverse environments
ctu01130  Biosynthesis of antibiotics
ctu01200  Carbon metabolism
ctu01230  Biosynthesis of amino acids
Module
ctu_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:ctu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CTU_18360 (pfkB)
   00030 Pentose phosphate pathway
    CTU_18360 (pfkB)
   00051 Fructose and mannose metabolism
    CTU_18360 (pfkB)
   00052 Galactose metabolism
    CTU_18360 (pfkB)
  Energy metabolism
   00680 Methane metabolism
    CTU_18360 (pfkB)
Enzymes [BR:ctu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     CTU_18360 (pfkB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PfkB Phos_pyr_kin DUF2617 Carb_kinase Semialdhyde_dh
Motif
Other DBs
NCBI-ProteinID: CBA30278
UniProt: C9Y2N5
Position
complement(1914052..1914981)
Genome map
AA seq 309 aa AA seqDB search
MVRIYTLTLAPSLDSATMTPQIYPEGKLRCSSPVFEPGGGGINVARAIVHLGGTATALFP
AGGATGEHLVSLLNDEHVAVETVSAHDWTRQNLHVHVESSGEQYRFVMPGATITDDEFRQ
LEEKVLAIESGAILVISGSLPPGVSIEKLQQLIKAARQQGIRLIVDSSGDALAAALEIGD
IELVKPNQKELAALVKRDLTAPDDVRQAAQELVQSGKARRVVVSLGPQGALGVDGKDCVQ
VVPPPMKSQSTVGAGDSMVGAMTLRLAQDAPLLDMVRYGVAAGSAATINQGTRLCSLENT
DRIYHWLTR
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atggtacggatttatacgcttacactggcgccctcgctcgacagcgccacaatgacgccg
caaatctacccggaagggaaactacgctgcagctcgccggtgtttgaacccggcggcggc
ggcattaatgtcgcgcgcgctattgtccatctgggcggcaccgcgaccgccctcttcccc
gcaggcggcgcgaccggcgagcatctggtttcgctgcttaatgatgaacacgtcgccgtg
gagacggtttccgcccatgactggacgcgtcagaatctccatgtgcatgtcgagtcgagc
ggcgagcagtaccgcttcgtgatgcccggcgccacaataaccgacgatgaattccgccag
cttgaagagaaagtcctggcgattgaatcaggcgccattctggttattagcggcagcctg
ccgcccggcgtcagcattgaaaaactccagcaacttattaaagccgcccgtcagcaaggg
atccgcctgattgtcgacagctccggcgacgcactcgccgccgcgctggagattggcgat
atcgaactggtcaaacccaaccagaaagagctggcggcgctggtgaaacgcgatctgacc
gcgccggatgacgtgcgccaggcggcgcaagaactggtgcagtcaggcaaagcccgccgc
gttgtcgtctcgctgggcccgcagggcgcgctcggcgttgatggtaaggactgcgttcag
gtcgtgccgccgccgatgaaaagccagagcaccgtcggcgcgggcgacagtatggttggc
gctatgacgctgcgtctggcgcaggacgccccgctgcttgatatggtgcgttacggcgtg
gccgccggtagcgccgccactatcaaccagggcacgcggctctgctcgctggaaaacacc
gatcgcatctatcactggctgactcgctaa

DBGET integrated database retrieval system