KEGG   Cronobacter turicensis: CTU_20270Help
Entry
CTU_20270         CDS       T00999                                 

Gene name
folM
Definition
dihydromonapterin reductase (EC:1.5.1.3)
Orthology
K13938  
dihydromonapterin reductase / dihydrofolate reductase [EC:1.5.1.- 1.5.1.3]
Organism
ctu  Cronobacter turicensis
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ctu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    CTU_20270 (folM)
   00670 One carbon pool by folate
    CTU_20270 (folM)
Enzymes [BR:ctu01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     CTU_20270 (folM)
    1.5.1.-  
     CTU_20270 (folM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2126539..2127249)
Genome map
AA seq 236 aa AA seqDB search
MDKPIVITGAGRRIGLALAHHFLAQQHDVIVSYRTHYPAIDVLEEAGAVCIEADFCHDDG
ILAFAEAVKARTTHIRALLHNASTWQDESPPVPPADVLNAMLQIHVHAPYLLNFALEPLL
RGQGHAACDIIHFTDYVVERGSAKYIAYAASKAALDNLTRSFARKLAPEVKVNAIAPSQI
LFNEHDDPEYRQKALNKSLMKIAPGEKEIIDLVDYLLTSRYVTGHSYPVNGGRPLR
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
ctggataaacccatcgttatcaccggcgcgggccgccgtatcggccttgcgctggcgcac
catttcctggcgcaacagcatgatgtgattgtcagctatcgcacccattacccggcgatt
gacgtgctggaagaggcgggcgcggtctgcattgaagccgatttctgccatgacgacggc
attctggcgtttgccgaggccgttaaagcgcgcaccacgcatattcgcgcgctattgcac
aacgccagcacctggcaggatgaaagcccgcctgttccgcccgctgatgtgctgaacgcc
atgctgcaaattcatgtgcatgcgccctatctcctgaacttcgcccttgagccgctgctg
cgcggccagggccacgccgcctgcgatattattcactttaccgattacgtcgtggagcgc
ggcagcgcgaaatacatcgcctatgccgcgagcaaagcggcgctcgataatctcacccgc
tcgtttgcgcgcaagctcgccccggaagtgaaagtgaacgccatcgcgccctcgcaaatt
ctctttaacgagcatgacgacccggagtaccgccagaaggcgctcaataaatcactgatg
aaaatcgcccccggcgaaaaagagattatcgatctggtggattatctccttaccagccgt
tacgtgaccggccacagctacccggtgaacggcggtcgtccgttgcgttaa

DBGET integrated database retrieval system